Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
Rabbit anti Human IgA
Rabbit anti-human IgA was raised in rabbit using human IgA alpha heavy chain as the immunogen.Purity:Min. 95%MRPS2 antibody
MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
