Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
WAS antibody
The WAS antibody is a polyclonal antibody used in life sciences research. It specifically targets the antigen-binding domain of the Wiskott-Aldrich syndrome (WAS) protein. This antibody is commonly used to detect protein carbonyls and has been extensively validated for use in various experimental settings. The WAS antibody is available as both monoclonal and polyclonal preparations, with the polyclonal form being particularly useful for neutralizing experiments. It can be used in a range of applications, including Western blotting, immunohistochemistry, and immunofluorescence. Additionally, this antibody has shown potential in studies involving polypeptide expression, anti-dnp antibodies, growth factors, caspase-9 signaling pathways, cholinergic systems, and bioassays. Researchers can rely on the high quality and specificity of the WAS antibody to advance their scientific investigations.
SSTR2 antibody
The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.
Vimentin protein antibody
The Vimentin protein antibody is a powerful tool for conducting antigen-antibody reactions in various research applications. This antibody specifically targets the vimentin protein, which plays a vital role in maintaining cell structure and integrity. It can be used to study vimentin expression levels, localization, and interactions with other proteins.
Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
SPARC antibody
The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.
CEBPB antibody
The CEBPB antibody is a highly specific antigen-antibody drug that targets actin, a protein involved in various cellular processes. This monoclonal antibody specifically binds to actin filaments in the nucleus, inhibiting their function and disrupting cellular activities. Additionally, this antibody has been shown to reduce microvessel density, indicating its potential as an anti-angiogenic agent.
Salbutamol antibody
The Salbutamol antibody is a highly specialized polyclonal antibody that targets the phosphatase growth factor-1 receptor. It is commonly used in life sciences research to study the effects of TGF-beta, collagen, and other growth factors. This antibody has been proven to have neutralizing properties, effectively blocking the activity of these growth factors and allowing researchers to better understand their role in various biological processes.
Purity:Min. 95%Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.Tetraspanin 17 antibody
Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIPurity:Min. 95%Keratin K16 antibody
Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.
Purity:Min. 95%GJC3 antibody
GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen
Purity:Min. 95%RNF43 antibody
RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRHPurity:Min. 95%NKAIN1 antibody
NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVPurity:Min. 95%Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
SPTLC1 antibody
The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.
CD38 antibody
The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.
GLYT1 antibody
GLYT1 antibody was raised in rabbit using a 20 amino acid peptide of rat GLYT1 as the immunogen.Purity:Min. 95%Hepatitis B Virus preS1 antibody
Hepatitis B Virus preS1 antibody was raised in mouse using hepatitis B virus as the immunogen.IFNAR2 antibody
IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.
GJB1 antibody
GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
GALC antibody
GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALPurity:Min. 95%STIP1 antibody
STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
