Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
PFKFB3 antibody
The PFKFB3 antibody is a highly specialized tool used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is designed to target and bind to specific proteins associated with PFKFB3. This antibody can be used in various applications such as solid phase assays, histidine quantitation, and messenger RNA analysis.
OAT antibody
OAT antibody was raised in mouse using recombinant human OAT (33-439aa) purified from E.coli as the immunogen.
p73 antibody
The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.
Leptin antibody (biotin)
Leptin antibody was raised in rabbit using highly pure recombinant murine leptin as the immunogen.
MCM4 antibody
MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE
IL7 antibody
IL7 antibody was raised in mouse using highly pure recombinant human IL-7 as the immunogen.PTS antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
GFAP antibody
The GFAP antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). This protein is primarily expressed in astrocytes, a type of glial cell in the central nervous system. The GFAP antibody has been extensively used in various research fields, including Life Sciences and Neuroscience.
Bax antibody
The Bax antibody is a monoclonal antibody that specifically targets the protein Bax. Bax plays a crucial role in regulating cell death and apoptosis. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
KYNU antibody
KYNU antibody is a polyclonal antibody that specifically targets kynureninase (KYNU), an enzyme involved in the metabolism of tryptophan. KYNU plays a crucial role in the production of kynurenic acid, which has been implicated in various neurological and psychiatric disorders. This antibody can be used in research assays to detect and quantify KYNU levels in biological samples, allowing for a better understanding of its function and potential therapeutic applications. With its high specificity and sensitivity, the KYNU antibody is a valuable tool for scientists and researchers working in the field of life sciences. Whether studying autoimmune diseases, developing new medicines, or exploring the role of kynurenine pathway intermediates, this antibody provides reliable results and contributes to advancements in biomedical research.
Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 26-35 of cTnI as the immunogen.
Angiopoietin 2 antibody
The Angiopoietin 2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody designed to neutralize the activity of Angiopoietin 2, a glycoprotein involved in angiogenesis and vascular remodeling. This antibody has been extensively tested and proven to be highly specific and effective in blocking the interaction between Angiopoietin 2 and its receptor, thereby inhibiting angiogenesis.
GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
PDK4 antibody
The PDK4 antibody is a powerful tool used in the field of Life Sciences. It is an autoantibody that specifically targets and binds to the nuclear phosphatase known as PDK4. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA).
MUC16 antibody
The MUC16 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets MUC16, also known as CA125, which is a transmembrane glycoprotein that is overexpressed in various types of cancer. By binding to MUC16, this antibody can exert cytotoxic effects on cancer cells and inhibit their growth.
GPT antibody
GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
Donkey anti Guinea Pig IgG (H + L) (HRP)
Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that specifically targets the chemokine CCL2. This antibody is designed to bind to CCL2, preventing its interaction with its receptor and inhibiting its activity. It can be used in various research applications, including immunoassays, western blotting, and immunohistochemistry.CAV1 antibody
CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
IL3 antibody
The IL3 antibody is a receptor molecule that has neutralizing properties. It is commonly used in hybridization and antibody-related research in the Life Sciences field. This antibody specifically targets interleukin-3 (IL-3), a cytokine that plays a crucial role in the production and differentiation of various blood cells. By binding to IL-3, the IL3 antibody can effectively block its activity, making it an essential tool for studying the function and regulation of IL-3.
BMP6 antibody
The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.
POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
