Primary Antibodies

Purified Rabbit anti-SLC30A9 Antibody

Rabbit polyclonal TCEB3 antibody

GATA2 antibody was raised in Rabbit using Human GATA2 as the immunogen

ABHD14A antibody was raised in Rabbit using Human ABHD14A as the immunogen

Rabbit polyclonal TSC22D4 antibody

Mouse monoclonal Cytochrome C antibody (FITC)

Affinity purified Rabbit polyclonal POLR3A antibody

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

Keratin K1 antibody was raised in Guinea Pig using synthetic peptide of human keratin K1 coupled to KLH as the immunogen.

CD4 antibody (PE) was raised in mouse using feline CD4 as the immunogen.

Anti-Feline Leukemia Virus antibody

STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen

The HDAC2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects hepatocyte growth factor (HGF), fibronectin, collagen, and other important proteins. This antibody is widely used in research laboratories for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It can be used to study the expression and localization of HGF and other proteins in different tissues and cell types. The HDAC2 antibody is also commonly used in drug discovery and development to evaluate the effect of potential inhibitors on protein complexes involved in growth factor signaling pathways. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of cell biology, molecular biology, and drug development.

6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive human activity studies using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, such as ESX-1 secretion system protein, effectively inhibiting cell growth in culture.

The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.

CHRNA6 antibody was raised in Rabbit using Human CHRNA6 as the immunogen

Rabbit polyclonal CDK1 antibody (Tyr15)

The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.

The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.

The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.

The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.

The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.

IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Affinity purified Rabbit polyclonal BCAP31 antibody

CDC27 antibody was raised in Rabbit using Human CDC27 as the immunogen

IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL

CA3 antibody was raised in Rabbit using Human CA3 as the immunogen

Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.

SURF1 antibody was raised in rabbit using the N terminal of SURF1 as the immunogen

Affinity purified Mouse polyclonal EPHA1 antibody

The CD29 antibody is a highly effective monoclonal antibody that has multiple applications in the field of biotechnology. It can be used as a growth factor, a cdk4/6 inhibitor, and an antiviral agent. The CD29 antibody contains excipients such as globulin, which enhance its stability and efficacy. This powerful antibody has neutralizing properties and can effectively target molecules involved in various biological processes.

DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS

The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.

The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.

Affinity purified Rabbit polyclonal STRA8 antibody

Cdk7 antibody was raised in mouse using recombinant C-terminal 221 aa fragment of human wild-type cdk7/CAK (cyclin activating kinase) as the immunogen.

The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.

PGM5 antibody was raised in rabbit using the N terminal of PGM5 as the immunogen

Rabbit polyclonal GSK3 alpha/beta antibody

CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.

RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF

NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

ABCF2 antibody was raised in Rabbit using Human ABCF2 as the immunogen

Sheep polyclonal Lorazepam antibody

CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.

Rabbit polyclonal IRX1 antibody

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Rabbit polyclonal ZNF225 antibody

PDCD8 antibody was raised in rabbit using the N terminal of PDCD8 as the immunogen

The TAP antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications. This antibody is specifically designed to target and neutralize epidermal growth factor (EGF) and hepatocyte growth factor (HGF), two important growth factors involved in various biological processes.

SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.