Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
PCT monoclonal antibody
The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.MLSTD2 antibody
MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
SSRP1 antibody
The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.
alpha Actin antibody
The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.
MEF2A antibody
The MEF2A antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the MEF2A protein, which plays a crucial role in various cellular processes including growth factor signaling and interferon production. This antibody can be used for a wide range of applications, such as western blotting, immunofluorescence, and immunohistochemistry.
Purity:Min. 95%Ephrin A1 antibody
The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.
Galectin 3 antibody
Galectin 3 antibody was raised in mouse using full length recombinant human galectin-3 as the immunogen.
CD22 antibody
The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.
S100B antibody
The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.
Lysozyme antibody
The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.
MOR antibody
The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
CD25 antibody (PE-CY7)
CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molMVD antibody
The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
CD4a antibody (PE)
CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCELSR3 antibody
CELSR3 antibody is a powerful antiviral agent that targets the lipoprotein lipase, a key enzyme involved in viral replication. This monoclonal antibody acts as a medicament by neutralizing the growth factor required for viral proliferation. The colloidal nature of this antibody allows for efficient targeting and binding to specific viral particles. Additionally, CELSR3 antibody exhibits high specificity towards the CD20 antigen, making it an effective therapeutic option for diseases characterized by abnormal CD20 expression. Its unique glycosylation pattern and fatty acid modifications enhance its stability and prolong its half-life in circulation. With its potent antiviral properties and precise targeting capabilities, CELSR3 antibody is a promising tool in the field of life sciences for combating viral infections.
Tim17 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
VEGFC antibody
The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.
GPR45 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
NOD2 antibody
The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.
Claudin 17 antibody
Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
CD45RB antibody (Spectral Red)
CD45RB antibody (FITC) was raised in rat using cloned mouse Th2 cell lines as the immunogen.
RPE antibody
RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
LDL Receptor antibody (biotin)
LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.
FARS2 antibody
FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
ATE1 antibody
ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
CD117 antibody (Spectral Red)
CD117 antibody (PE) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
PSA antibody (HRP)
PSA antibody (HRP) was raised in mouse using highly pure human PSA as the immunogen.Purity:Min. 95%Dengue NS1 antibody
The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
