Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
APC antibody
The APC antibody is a monoclonal antibody that targets the endogenous hematopoietic growth factor known as insulin. This antibody specifically binds to the activated form of APC (activated protein C), which plays a crucial role in anticoagulant and anti-inflammatory processes. The APC antibody has been extensively studied in various life sciences research areas, including cancer biology and angiogenesis. It has shown promising results as an anti-VEGF (vascular endothelial growth factor) therapy, inhibiting the growth of blood vessels and tumor cells. This molecule drug has also been tested in human serum samples, demonstrating its potential clinical applications. In addition to its therapeutic use, polyclonal antibodies targeting APC have been developed for diagnostic purposes in various diseases and disorders.
Tie2 antibody
The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.
AVPV1a antibody
AVPV1a antibody was raised in rabbit using 19aa peptide of rat AVP-VIa receptor. as the immunogen.Purity:Min. 95%Keratin K16 antibody
Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.
Purity:Min. 95%anti-Goat IgG h+l Antibody (BIOTIN)
Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.
Purity:Min. 95%BAG2 antibody
BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK
Carboxypeptidase E antibody
Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Purity:Min. 95%ANKRA2 antibody
ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen
Purity:Min. 95%AKT3 antibody
The AKT3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the c-myc protein, which is involved in cell growth and proliferation. This antibody has a high affinity for its target and can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.Shpk antibody
Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen
Purity:Min. 95%ATF3 antibody
ATF3 antibody was raised in mouse using recombinant Human Activating Transcription Factor 3D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.Goat anti Guinea Pig IgG (H + L)
Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.
Purity:Min. 95%vacA antibody
The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.Purity:Min. 95%Fibronectin 1 antibody
Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIPurity:Min. 95%HIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.Purity:Min. 95%VSV-G antibody
VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.
Purity:Min. 95%PPAR alpha antibody
PPAR Alpha antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) V D T E S P I C P L S P L E A D D(18) C of mouse PPAR alpha.Purity:Min. 95%CRYAB antibody
The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.
CPA1 antibody
The CPA1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory responses. This antibody has shown efficacy in blocking the activity of TNF-α, which plays a crucial role in various diseases and conditions. Studies have also demonstrated that the CPA1 antibody can inhibit the production of interleukin-6 and interferon, both of which are involved in immune responses. Additionally, this monoclonal antibody has been shown to bind to transferrin, a biomolecule involved in iron transport, as well as nuclear receptors. The CPA1 antibody holds promise for therapeutic applications due to its ability to target specific proteins and disrupt protein complexes involved in disease pathogenesis.
CD154 antibody (PE)
CD154 antibody (FITC) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.
Purity:Min. 95%Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.TFG antibody
TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.
ATG5 antibody
ATG5 antibody was raised in rabbit using the middle region of ATG5 as the immunogenPurity:Min. 95%PAI1 antibody
PAI1 antibody was raised in sheep using Recombinant Plasminogen Activator Inhibitor-1 prepared from bacterial extracts as the immunogen.Purity:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%BHMT antibody
The BHMT antibody is a monoclonal antibody that specifically targets CD33, a receptor protein expressed on the surface of certain cells. This antibody is widely used in Life Sciences research and immunoassays to detect and study CD33-related processes. The BHMT antibody has a high affinity for CD33 due to its unique binding site, which allows for accurate and reliable detection. It can be used in various applications such as flow cytometry, immunohistochemistry, and Western blotting. Additionally, this antibody has been utilized in studies investigating collagen synthesis, disulfide bond formation, glucagon signaling, TNF-α inhibition, and the presence of autoantibodies. With its exceptional specificity and sensitivity, the BHMT antibody is an invaluable tool for researchers studying CD33-related pathways and diseases.
CERK antibody
CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PPP1R13B antibody
PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAPurity:Min. 95%Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%PCNP antibody
The PCNP antibody is a highly specialized and versatile product used in the field of Life Sciences. This antibody is derived from adeno-associated virus and has been pegylated for enhanced stability and efficacy. It specifically targets actin filaments, which play a crucial role in various cellular processes.
FAK antibody
The FAK antibody is a powerful tool in the field of Life Sciences. It is an antiviral antibody that specifically targets and neutralizes a cell antigen known as focal adhesion kinase (FAK). FAK is a key regulator of cell growth, migration, and survival, making it an important target for research and therapeutic applications.
Scamp5 antibody
Scamp5 antibody was raised in rabbit using the C terminal of Scamp5 as the immunogen
Purity:Min. 95%CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Purity:Min. 95%DDX4 antibody
The DDX4 antibody is a monoclonal antibody that specifically targets the DDX4 cell antigen. This antibody plays a crucial role in various cellular processes, including exocytosis and phosphatase activity. It has been shown to modulate the production of interleukin-6 (IL-6), a key cytokine involved in immune responses. The DDX4 antibody also exhibits high specificity towards antigens such as hemagglutinin, transferrin, and glycosylation markers. In Life Sciences research, this antibody is widely used for nuclear staining and detection of DDX4 expression. Its unique binding properties make it an invaluable tool for studying cellular processes and protein interactions. With its exceptional performance and reliability, the DDX4 antibody is the go-to choice for researchers in the field of immunology and molecular biology.
HAO1 antibody
The HAO1 antibody is a monoclonal antibody that specifically targets and binds to the HAO1 protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.
Perilipin (C terminal) antibody
Perilipin (C terminal) antibody was raised in Guinea Pig using C-terminus of perilipin as the immunogen.
Purity:Min. 95%Goat anti Mouse IgG + IgM (H + L) (Texas Red)
Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.PGP9.5 antibody
PGP9.5 antibody was raised in mouse using recombinant human PGP9.5 (1-223aa) purified from E. coli as the immunogen.Arginase 2 antibody
Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
CD90.2 antibody (Spectral Red)
CD90.2 antibody (Spectral Red) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
