Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
MRPS2 antibody
MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
METTL2B antibody
METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS
Complement C5 antibody
Complement C5 antibody was raised in mouse using human complement component C5 as the immunogen.
NAGS antibody
NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
CHCHD6 antibody
CHCHD6 antibody was raised in rabbit using the middle region of CHCHD6 as the immunogen
SRPRB antibody
SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Purity:Min. 95%HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
Goat anti Rat IgG (H + L) (Fab'2) (rhodamine)
Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.
Purity:Min. 95%GFP antibody (biotin)
GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.
PTGFRN antibody
The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.
CX40.1 antibody
CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG
C5 antibody
The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.
Goat anti Human IgG (H + L) (HRP)
Goat anti Human IgG (H + L) secondary antibody (HRP)Purity:Min. 95%Arginase I antibody
The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.
POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
RHEB antibody
The RHEB antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used to detect and target RHEB, a protein involved in various cellular processes. This antibody has been extensively studied for its ability to inhibit the activity of RHEB, making it a valuable tool for research and therapeutic applications.
PUS10 antibody
PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
MBP antibody
MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.Cytokeratin 16 antibody
Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD
CTBP1 antibody
The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.
PPP1R3B antibody
PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen
Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%HDAC2 antibody
The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
MMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
Luteinizing Hormone antibody
Luteinizing hormone antibody was raised in mouse using human pituitary luteinizing hormone as the immunogen.CHKA antibody
CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
BHMT antibody
The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.
NT4 antibody
NT4 antibody was raised in mouse using highly pure recombinant human NT-4 as the immunogen.CAV1 antibody
The CAV1 antibody is a highly specialized medicament that is used in various research and diagnostic applications. It specifically targets caveolin-1, a protein that plays a crucial role in cell signaling and membrane trafficking. The CAV1 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.
TLR8 antibody
The TLR8 antibody is a specific antibody used in Life Sciences to neutralize the activity of Toll-like receptor 8 (TLR8). TLR8 plays a crucial role in the immune response by recognizing and binding to various pathogen-associated molecular patterns. This antibody has been shown to inhibit the activation of TLR8 by blocking its interaction with ligands such as single-stranded RNA. By doing so, it prevents downstream signaling pathways that lead to the production of inflammatory cytokines like TNF-α and chemokines. Additionally, this antibody has been found to modulate collagen synthesis, fibronectin expression, and epidermal growth factor (EGF)-like growth factors. Its versatility makes it an essential tool for research in immunology and related fields.
Factor V antibody
Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
