Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
LRRC2 antibody
LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ
GOT2 antibody
GOT2 antibody was raised in Mouse using a purified recombinant fragment of human GOT2 expressed in E. coli as the immunogen.ITGA3 antibody
The ITGA3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing proteins. It is a polyclonal antibody that can be used in various life science applications. The ITGA3 antibody has been shown to have an inhibitory effect on colony-stimulating factors and fibrinogen, which are important for cell growth and survival. This antibody can also activate phosphatase and 3-kinase pathways, which play a role in cellular signaling. Additionally, the ITGA3 antibody has been used as a monoclonal antibody to target TNF-related apoptosis-inducing molecules and inhibit their activity. Studies have also shown that this antibody can reduce microvessel density, suggesting its potential as an anti-angiogenic agent.
CD81 antibody
CD81 antibody was raised in hamster using murine epithelial cell line PAM212 as the immunogen.
CDK5 antibody
The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.
CD18 antibody
The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.
Tenascin antibody
The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.
COX15 antibody
COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
SC4MOL antibody
SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Factor XIIIa antibody
Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.
Glyoxalase I antibody
The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.
CCL2 antibody
The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.
PHEX antibody
The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.
MtSSB antibody
The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.
MST4 antibody
The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.
E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
BCAT1 antibody
The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.
Amylin antibody
The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.
FGFR2 antibody
The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.
RBP1 antibody
The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
NFS1 antibody
NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
RBM5 antibody
The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.
Cystatin B antibody
The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.
EPS8L1 antibody
EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE
GST antibody
The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.
Fibronectin antibody
The Fibronectin antibody is a polyclonal antibody that specifically targets fibronectin, a glycoprotein involved in cell adhesion and migration. This antibody is widely used in life sciences research to study the role of fibronectin in various biological processes. It can be used to detect and quantify fibronectin levels in different samples, such as tissues or cell cultures. The Fibronectin antibody has also been shown to have potential therapeutic applications, particularly in cancer treatment. Studies have demonstrated its ability to inhibit tumor growth by blocking the interaction between fibronectin and its receptor on cancer cells. Additionally, this antibody has been used in combination with other drugs, such as sorafenib, to enhance their anti-cancer effects. Whether you are conducting research or developing new therapies, the Fibronectin antibody is an essential tool for studying fibronectin biology and its potential applications in various fields of medicine.
Annexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.
IFI44L antibody
IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Insulin antibody
Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
