Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Survivin antibody
The Survivin antibody is a monoclonal antibody that targets survivin, a protein that plays a crucial role in cell division and inhibition of apoptosis. This antibody specifically binds to survivin and can be used for various applications in Life Sciences research.
UXT antibody
UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
Cystatin B antibody
The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.
PDPN antibody
The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.
EPS8L1 antibody
EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa730-871) expressed in E. coli as the immunogen.Triiodothyronine antibody
Triiodothyronine antibody is a monoclonal antibody that specifically targets and inhibits the activity of tyrosine kinase receptors. It is commonly used in life sciences research to study the role of these receptors in various cellular processes. Triiodothyronine antibody has been shown to effectively neutralize the growth factor signaling pathway by blocking the interaction between growth factors and their receptors. This inhibition leads to a decrease in cell proliferation and survival. Additionally, this antibody can be used in cytotoxic assays to assess the efficacy of tyrosine kinase inhibitors, such as imatinib. The binding of triiodothyronine antibody to its target receptor also results in dephosphorylation events mediated by phosphatases, which further modulate cellular responses. Its specificity and ability to inhibit tyrosine kinase activity make triiodothyronine antibody a valuable tool for studying signal transduction pathways and developing targeted therapies against diseases driven by aberrant receptor activation.Interferon gamma antibody
The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.
HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesCDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
CSE1L antibody
The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
MMP1 antibody
MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.
ZC3H12A antibody
The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.
PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
SSRP1 antibody
The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.
alpha Actin antibody
The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.
Ephrin A1 antibody
The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.
Galectin 3 antibody
Galectin 3 antibody was raised in mouse using full length recombinant human galectin-3 as the immunogen.
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
MCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
RGS20 antibody
RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
