Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
CMV antibody (biotin)
CMV antibody (biotin) was raised in goat using purified virions of strain AD169 as the immunogen.Survivin antibody
The Survivin antibody is a monoclonal antibody that targets survivin, a protein that plays a crucial role in cell division and inhibition of apoptosis. This antibody specifically binds to survivin and can be used for various applications in Life Sciences research.
UXT antibody
UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
Beta Lactoglobulin antibody
The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.
Src antibody
The Src antibody is a specific antibody used in Life Sciences research. It targets protein tyrosine kinases, specifically the Src family of kinases. This antibody has been shown to induce apoptosis in various cell types by activating the TNF-related apoptosis-inducing ligand (TRAIL) pathway. It can also inhibit the activity of interferon and epidermal growth factor signaling pathways. The Src antibody is available in stable liquid formulations for easy handling and storage. Whether you need a monoclonal or polyclonal antibody, the Src antibody is a reliable choice for your research needs. Additionally, studies have suggested that this antibody may have potential therapeutic applications in conditions such as hepatic steatosis.
Connexin 43 antibody
The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.
GABRB2 antibody
GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR
CCR10 antibody
The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.
TNFSF9 antibody
The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.
NLK antibody
The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.
TNFRSF18 antibody
TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen
Triiodothyronine antibody
Triiodothyronine antibody is a monoclonal antibody that specifically targets and inhibits the activity of tyrosine kinase receptors. It is commonly used in life sciences research to study the role of these receptors in various cellular processes. Triiodothyronine antibody has been shown to effectively neutralize the growth factor signaling pathway by blocking the interaction between growth factors and their receptors. This inhibition leads to a decrease in cell proliferation and survival. Additionally, this antibody can be used in cytotoxic assays to assess the efficacy of tyrosine kinase inhibitors, such as imatinib. The binding of triiodothyronine antibody to its target receptor also results in dephosphorylation events mediated by phosphatases, which further modulate cellular responses. Its specificity and ability to inhibit tyrosine kinase activity make triiodothyronine antibody a valuable tool for studying signal transduction pathways and developing targeted therapies against diseases driven by aberrant receptor activation.Interferon gamma antibody
The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.
HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesCDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
CSE1L antibody
The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
CSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
SGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
