Primary Antibodies

Affinity purified Rabbit polyclonal RPA32 antibody

EIF4EBP2 antibody was raised in Rabbit using Human EIF4EBP2 as the immunogen

The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.

The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.

Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

Affinity purified Rabbit polyclonal PEX13 antibody

FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

Rabbit polyclonal GABRB2 antibody

Loricrin antibody was raised using the N terminal of LOR corresponding to a region with amino acids GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSG

TNFRSF25 antibody was raised in rabbit using the middle region of TNFRSF25 as the immunogen

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal SYT1 antibody (Ser309)

sRANKL antibody (biotin) was raised in goat using highly pure recombinant human sRANKL as the immunogen.

Affinity purified Rabbit polyclonal PSMC6 antibody

Rabbit polyclonal EDG2 antibody

The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.

Rabbit polyclonal CDK1 antibody (Tyr15)

CHRNA6 antibody was raised in Rabbit using Human CHRNA6 as the immunogen

The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.

CD4 antibody (PE) was raised in mouse using feline CD4 as the immunogen.

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

ABHD14A antibody was raised in Rabbit using Human ABHD14A as the immunogen

Affinity purified Rabbit polyclonal Caspase 4 antibody

Fractalkine antibody is an antigen-specific antibody that targets the chemokine known as fractalkine. It is commonly used in Life Sciences research and is available in both polyclonal and monoclonal forms. This antibody has the ability to bind to fractalkine, leading to lysis or cross-linking of the target molecule. The activated antibody can also be used as a neutralizing agent against extracellular polysaccharides. Fractalkine antibody is widely used in various applications, including immunohistochemistry, flow cytometry, and Western blotting, to study the role of fractalkine in different biological processes. With its high specificity and affinity for fractalkine, this antibody provides researchers with a valuable tool for investigating the functions and mechanisms of this important chemokine in various contexts.

Affinity purified Rabbit polyclonal ULK2 antibody

Affinity purified Rabbit polyclonal DPRP1 antibody

ATP11B antibody was raised in Rabbit using Human ATP11B as the immunogen

The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.

MYOT antibody was raised in Rabbit using Human MYOT as the immunogen

Affinity purified Rabbit polyclonal SGTA antibody

Rabbit polyclonal FAKD1 antibody

The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.

The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.

DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody

Affinity purified Rabbit polyclonal SART1 antibody

The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

Rabbit polyclonal GRIN1 antibody (Splice Variant C1)

NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

The Src antibody is a specific antibody used in Life Sciences research. It targets protein tyrosine kinases, specifically the Src family of kinases. This antibody has been shown to induce apoptosis in various cell types by activating the TNF-related apoptosis-inducing ligand (TRAIL) pathway. It can also inhibit the activity of interferon and epidermal growth factor signaling pathways. The Src antibody is available in stable liquid formulations for easy handling and storage. Whether you need a monoclonal or polyclonal antibody, the Src antibody is a reliable choice for your research needs. Additionally, studies have suggested that this antibody may have potential therapeutic applications in conditions such as hepatic steatosis.

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.

Affinity purified Rabbit polyclonal ATP synthase delta antibody

GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR

The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.

DBNL antibody was raised in Rabbit using Human DBNL as the immunogen

The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

Rabbit polyclonal PRKCSH antibody

Purified Rabbit polyclonal MBL2 antibody

Affinity purified Rabbit polyclonal Perforin 1 antibody

The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.

Affinity purified Rabbit polyclonal C5L2 antibody

RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

The MPP1 antibody is a powerful tool in the field of life sciences. It belongs to the class of antibodies and specifically targets interleukin, an important cytokine involved in various immune responses. This antibody can be used in assays and experiments to detect and measure the levels of interleukin in samples. It is also useful for studying autoantibodies, which are antibodies that target the body's own tissues.

The CDK2 antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to cyclin-dependent kinase 2 (CDK2), a protein that plays a crucial role in cell cycle regulation. By binding to CDK2, this antibody can inhibit its activity and prevent cell division.

Armenian Hamster monoclonal CD49e antibody (FITC)

Affinity purified Rabbit polyclonal ADAMTSL2 antibody

Affinity purified Rabbit polyclonal PEX19 antibody

The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.

TBCD antibody was raised in rabbit using the N terminal of TBCD as the immunogen

The UBE2L3 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the UBE2L3 protein, which plays a crucial role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

Purified Polyclonal NEIL3 antibody

Affinity purified Rabbit polyclonal XPNPEP2 antibody

Goat anti Pig IgM secondary antibody (Alk Phos)

The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.

CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.

RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

Affinity purified Rabbit polyclonal Tetraspan 1 antibody

Rabbit polyclonal CYC1 antibody (HRP)

IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.

IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT

Affinity purified Rabbit polyclonal PSCDBP antibody

Rabbit polyclonal CaMK2 alpha/beta/theta antibody

Affinity purified Rabbit polyclonal PMM2 antibody

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.