Primary Antibodies

Rabbit polyclonal RRAS2 antibody

Rabbit polyclonal GABRB2 antibody

FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

Affinity purified Rabbit polyclonal PEX13 antibody

Tyrosine hydroxylase antibody was raised in mouse using mouse monoclonal as the immunogen.

MYOZ2 antibody was raised in Rabbit using Human MYOZ2 as the immunogen

ENPEP antibody is a monoclonal antibody that specifically targets ENPEP, an enzyme involved in the metabolism of progesterone and interferon. This antibody can be used for various applications in life sciences, including research on growth hormone receptor signaling, chemokine regulation, and steroid metabolism. It has also shown antiviral activity by inhibiting the replication of certain viruses in human serum. Additionally, this antibody has been used to detect ENPEP expression in tissues and cells using techniques such as immunohistochemistry and flow cytometry. Its high specificity and affinity make it a valuable tool for studying ENPEP-related processes and developing potential therapeutic strategies.

Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.

LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.

EIF4EBP2 antibody was raised in Rabbit using Human EIF4EBP2 as the immunogen

Affinity purified Rabbit polyclonal RPA32 antibody

The FLAG Tag antibody is a protein complex that consists of Polyclonal Antibodies. It has neutralizing properties and can target specific growth factors. This antibody is used in the field of Life Sciences to detect and analyze proteins in various research applications. The FLAG Tag antibody is designed to bind to the FLAG tag, which is a small peptide sequence that can be added to recombinant proteins for easy detection and purification. The antibody recognizes this tag and forms a stable complex with the protein of interest. This antibody is highly specific and exhibits low cross-reactivity with other proteins, making it an ideal tool for protein analysis. It can be used in various techniques such as Western blotting, immunoprecipitation, and immunofluorescence. In addition to its research applications, the FLAG Tag antibody also has potential therapeutic uses. It can be utilized as a medicament in the treatment of certain diseases where targeting specific proteins or growth factors is beneficial. The FLAG Tag antibody is produced using advanced techniques that

The BDNF antibody is a neuroprotective agent that acts as a family kinase inhibitor. It targets the adiponectin receptor, which is involved in various cellular processes related to adipose tissue. This antibody is commonly used in life sciences research and is available as both polyclonal and monoclonal antibodies.

The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.

BVES antibody was raised in Rabbit using Human BVES as the immunogen

Affinity purified Rabbit polyclonal APRT antibody

The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.

BUD31 antibody was raised in Rabbit using Human BUD31 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Affinity purified Rabbit polyclonal Glycerol kinase 2 antibody

Rabbit polyclonal ARF5 antibody (HRP)

BHLHE41 antibody was raised in Rabbit using Human BHLHE41 as the immunogen

KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Affinity purified Rabbit polyclonal ACTL8 antibody

Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen

Affinity purified Rabbit polyclonal beta Tubulin 4 antibody

CHRNA3 antibody was raised in rabbit using the N terminal of CHRNA3 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Affinity purified Rabbit polyclonal FGFR1 antibody

The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.

The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.

The PML antibody is a monoclonal antibody that specifically targets the protein known as promyelocytic leukemia (PML). It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. The PML antibody binds to PML, inhibiting its activity and preventing its interaction with other proteins. This antibody has been shown to have neutralizing effects on PML function, making it a valuable tool for studying the role of PML in various cellular processes. Additionally, the PML antibody has been conjugated with different tags such as fluorescein isothiocyanate (FITC) or horseradish peroxidase (HRP), allowing for easy detection and visualization of PML in cells and tissues. With its high specificity and affinity, the PML antibody provides researchers with a reliable tool for investigating the function of PML and its potential involvement in disease processes.

Purified Polyclonal BAF170 antibody

PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.

Purified Polyclonal EAAT3 antibody

Affinity purified Rabbit polyclonal Cytochrome P450 4A11 antibody

The GAPDH antibody is a highly specific monoclonal antibody that is used for various applications in the field of Life Sciences. This antibody has been extensively tested and validated using human serum samples, making it a reliable tool for research. It binds specifically to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis and other cellular processes.

VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

RPS9 antibody was raised in rabbit using the C terminal of RPS9 as the immunogen

CHRNB1 antibody was raised in Rabbit using Human CHRNB1 as the immunogen

Affinity purified Rabbit polyclonal RASA3 antibody

Rabbit polyclonal MAD4 antibody

DDX58 antibody was raised in Rabbit using Human DDX58 as the immunogen

The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.

Rabbit polyclonal SMTNL1 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This powerful drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

Affinity purified Rabbit polyclonal ACOX3 antibody

Rabbit polyclonal WRKY37 antibody

Rabbit polyclonal ZNF133 antibody

Sheep polyclonal Dipyrone antibody

Rabbit polyclonal VEZT antibody

The HSP60 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the acyl-CoA-binding protein (ACBP) and can be used in various immunoassays to detect and measure the levels of ACBP in different samples. ACBP is a glycoprotein that plays a crucial role in fatty acid metabolism and transport within cells. The HSP60 antibody can be used to study the expression and localization of ACBP in different cell types, including human endothelial cells and adipose tissue. It can also be used to investigate the interaction between ACBP and other proteins, such as growth factors, in order to better understand their roles in cellular processes. The HSP60 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it an invaluable tool for studying the functions of ACBP in cellular biology.

PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT

Rat monoclonal CIRE antibody (PE)

Rabbit polyclonal IL8R beta antibody (Ser347)

Rabbit polyclonal NPHP4 antibody

The CD80 antibody is a highly effective and versatile tool in the field of Life Sciences. This monoclonal antibody has a colloidal structure that allows it to efficiently bind to collagen and other target molecules. It is commonly used in research and diagnostic applications, particularly in the study of TGF-beta signaling pathways.

Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.

SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

ERBB2 antibody was raised in Rabbit using Human ERBB2 as the immunogen

The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.

BCL7B antibody was raised in Rabbit using Human BCL7B as the immunogen

The S100 antibody is a highly specialized monoclonal antibody that is reactive and cytotoxic. It is widely used in Life Sciences research for its neutralizing properties. This antibody specifically targets collagen, a crucial glycoprotein involved in various cellular processes such as growth factor signaling and cell adhesion. The S100 antibody has shown promising results in studies involving mesenchymal stem cells, where it has been found to have an immobilization effect on these cells. Additionally, this antibody can also be used in combination with polyclonal antibodies to target specific proteins, such as hepatocyte growth factor. Its unique mechanism of action involves inhibiting the activity of subtilisin/kexin type enzymes, further enhancing its therapeutic potential.

GUCY1A3 antibody was raised in Rabbit using Human GUCY1A3 as the immunogen

Affinity purified Rabbit polyclonal Vanin 1 antibody

EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen

The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.

Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.

Affinity purified Rabbit polyclonal SLC6A4 antibody

Affinity purified Rabbit polyclonal PPP3CB antibody

Mouse monoclonal PYCRL antibody

Affinity purified Rabbit polyclonal GULP1 antibody

Purified Rabbit polyclonal ZNF540 antibody

Rabbit polyclonal RIOK3 antibody

Affinity purified Rabbit polyclonal HHEX antibody

Affinity purified Rabbit polyclonal LETM1 antibody

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.