Primary Antibodies

The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.

ANXA3 antibody was raised in Rabbit using Human ANXA3 as the immunogen

IFT74 antibody was raised in rabbit using the C terminal of IFT74 as the immunogen

Rabbit polyclonal IL1RA antibody

Affinity purified Rabbit polyclonal SHC4 antibody

ARHGDIG antibody was raised in Rabbit using Human ARHGDIG as the immunogen

Affinity purified Rabbit polyclonal HMMR antibody

TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.

Affinity purified Rabbit polyclonal MYBPC2 antibody

MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

GALNS antibody was raised in Rabbit using Human GALNS as the immunogen

AP1M1 antibody was raised in Rabbit using Human AP1M1 as the immunogen

Affinity purified Rabbit polyclonal XRCC2 antibody

Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.

Rabbit polyclonal ALPI antibody

The BIM antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is known for its cytotoxic properties. This colloidal antibody specifically targets epidermal growth factor (EGF) and acts as a neutralizing agent against it. It is also effective against other growth factors such as TGF-beta. The BIM antibody comes in both polyclonal and monoclonal forms, providing options for different research needs. In addition to its role in inhibiting the activity of EGF-like molecules, this antibody has shown potential in targeting chemokines and endothelial growth factors. The BIM antibody is carefully formulated with buffer solutions to ensure stability and optimal performance. It can be used in various research applications within the Life Sciences field, making it an essential tool for scientists and researchers alike.

The PGCP antibody is a synthetic polyclonal antibody that specifically targets glutamate. It can be used in Life Sciences research for various applications, including staining and detection of glutamate in cells and tissues. The antibody solution contains streptavidin-conjugated alkaline phosphatase, which allows for chromogenic or fluorescent detection methods. The PGCP antibody has high affinity and specificity towards glutamate, making it a valuable tool for studying the role of this neurotransmitter in biological processes. Its conjugation to alkaline phosphatase enables easy visualization and quantification of glutamate levels in samples using chromogenic or fluorescent molecules.

IL17A antibody is a monoclonal antibody that specifically targets and inhibits the activity of IL-17A, a cytokine involved in immune responses and inflammation. IL-17A plays a crucial role in various autoimmune diseases and inflammatory conditions. The IL17A antibody binds to IL-17A receptors, preventing the interaction between IL-17A and its receptors. This inhibition leads to a reduction in the production of pro-inflammatory molecules and cytokines, thereby suppressing the immune response. The IL17A antibody is widely used in immunoassays to detect and quantify IL-17A levels in biological samples. It is also utilized in research studies to investigate the role of IL-17A in different diseases and as a potential therapeutic target for treating inflammatory disorders. With its high specificity and potency, the IL17A antibody provides researchers with valuable tools for understanding the complex mechanisms underlying immune system dysregulation.

HLA-DQA2 antibody was raised using the N terminal of HLA-DQA2 corresponding to a region with amino acids GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

The PTGES3 antibody is a highly specialized product used in the field of Life Sciences. It is an isolated nucleic acid that specifically targets the PTGES3 gene, which encodes for the enzyme prostaglandin E synthase 3. This enzyme plays a crucial role in the synthesis of prostaglandins, which are important signaling molecules involved in various physiological processes such as inflammation and pain.

NKRF antibody was raised in Rabbit using Human NKRF as the immunogen

The MCD antibody is a powerful tool used in Life Sciences research for various applications. It is commonly used in transcription-polymerase chain reaction (PCR) experiments to detect and amplify specific DNA sequences. The MCD antibody specifically targets terminal deoxynucleotidyl transferase, an enzyme involved in DNA synthesis and repair. By binding to this enzyme, the MCD antibody allows researchers to study its role in different biological processes.

SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

AAAS antibody was raised in Rabbit using Human AAAS as the immunogen

PDLIM1 antibody was raised in rabbit using the C terminal of PDLIM1 as the immunogen

GBA antibody is a highly specific monoclonal antibody that targets molecules involved in necrosis factor-related apoptosis-inducing and growth factor signaling pathways. It binds to specific proteins within the protein complex, effectively neutralizing their activity. This antibody can be used in various applications in Life Sciences, including research and diagnostics. GBA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been shown to have high affinity and specificity for its target molecule, making it a valuable tool in studying various biological processes. Additionally, GBA antibody has been tested and validated in human serum samples, ensuring its reliability and accuracy in clinical settings.

The CXCL9 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target and neutralize the chemokine CXCL9, which plays a crucial role in various immune responses. This antibody has been extensively tested and proven to have high affinity and specificity for its target.

The ITGA3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing proteins. It is a polyclonal antibody that can be used in various life science applications. The ITGA3 antibody has been shown to have an inhibitory effect on colony-stimulating factors and fibrinogen, which are important for cell growth and survival. This antibody can also activate phosphatase and 3-kinase pathways, which play a role in cellular signaling. Additionally, the ITGA3 antibody has been used as a monoclonal antibody to target TNF-related apoptosis-inducing molecules and inhibit their activity. Studies have also shown that this antibody can reduce microvessel density, suggesting its potential as an anti-angiogenic agent.

CD81 antibody was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

Affinity purified Rabbit polyclonal SLC6A4 antibody

The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.

Affinity purified Rabbit polyclonal Vanin 1 antibody

The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.

ERBB2 antibody was raised in Rabbit using Human ERBB2 as the immunogen

CENPO antibody was raised in Rabbit using Human CENPO as the immunogen

The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.

Rabbit polyclonal NRBP2 antibody

COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.

The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.

Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal BLZF1 antibody

The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.

The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.

Affinity purified Rabbit polyclonal IRAK3 antibody

APOBEC3G antibody was raised in Rabbit using Human APOBEC3G as the immunogen

Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Human ESE1 internal region immunogen; affinity purified Rabbit polyclonal ESE1 antibody

Rabbit polyclonal PAIP1 antibody

OR6C70 antibody was raised using the C terminal of OR6C70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

Mouse monoclonal SERPINB4 antibody

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.