Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
SIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
ABCB1 antibody
ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Goat anti Rat IgG (H + L) (HRP)
Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.Goat anti Mouse IgG + IgM (H + L)
Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.
Purity:Min. 95%GOT1 antibody
GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%CD45.1 antibody (Spectral Red)
CD45.1 antibody (Spectral Red) was raised in mouse using CD45.1 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molOXSM antibody
OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
CD8a antibody (CY5)
CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.
Purity:Min. 95%MAOA antibody
MAOA antibody is a monoclonal antibody that specifically targets the enzyme monoamine oxidase A (MAOA). This antibody plays a crucial role in regulating the levels of neurotransmitters such as serotonin, norepinephrine, and dopamine. By binding to MAOA, this antibody inhibits its activity and leads to an increase in the levels of these neurotransmitters.
GPR132 antibody
The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.CD56 antibody
The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.
Purity:Min. 95%TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
BMX antibody
BMX antibody was raised in Mouse using a purified recombinant fragment of human BMX expressed in E. coli as the immunogen.
CMV ICP36 antibody
CMV ICP36 antibody was raised in mouse using cytomegalovirus major DNA binding protein ICP36 as the immunogen.MCM2 antibody
The MCM2 antibody is a highly specialized growth factor that targets adipose tissue. It specifically binds to the adiponectin receptor, promoting the activation of epidermal growth factors and chemokines. This antibody has been shown to enhance the production of adiponectin, interferon, and dopamine in adipose cells.
VCP antibody
The VCP antibody is a highly specialized antibody that targets various proteins involved in crucial cellular processes. It specifically recognizes β-catenin, c-myc, alpha-synuclein, and other nuclear proteins. This antibody is widely used in the field of Life Sciences for research purposes.
FABP5 antibody
The FABP5 antibody is a highly potent and cytotoxic monoclonal antibody that targets a specific molecule in the body. Antibodies are proteins produced by the immune system to recognize and neutralize foreign substances. This particular antibody has been extensively studied in the field of Life Sciences due to its ability to inhibit the activity of a ubiquitin ligase, which plays a crucial role in cellular processes.
Leucine zipper protein 1 antibody
Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody
AMPK alpha antibody
The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
Goat anti Human IgA antibody (HRP)
Goat anti-human IgA (HRP) was raised in goat using human secretory IgA as the immunogen.SLC36A2 antibody
SLC36A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Purity:Min. 95%Mouse RBC antibody (FITC)
Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.
SGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
