Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
DDOST antibody
DDOST antibody was raised using the N terminal of DDOST corresponding to a region with amino acids SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
AKR1B10 antibody
AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
Borrelia burgdorferi antibody (FITC)
Borrelia burgdorferi antibody (FITC) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.STAT1 antibody
The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.
Purity:Min. 95%MCP2 antibody
MCP2 antibody was raised in mouse using highly pure recombinant human MCP-2 as the immunogen.
AMACR antibody
AMACR antibody was raised in Mouse using a purified recombinant fragment of human AMACR expressed in E. coli as the immunogen.PF4 antibody
PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.Purity:Min. 95%CD18 antibody
CD18 antibody was raised in Mouse using a purified recombinant fragment of CD18 expressed in E. coli as the immunogen.
Decorin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
CD272 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Extensive research has shown its effectiveness through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
phospho MBP antibody
Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.
STAT5A antibody
The STAT5A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets e-cadherin, a protein involved in cell adhesion and signaling. This antibody recognizes the tyrosine-phosphorylated form of STAT5A, which is important for its activation and transcriptional activity. The STAT5A antibody can be used to study the role of e-cadherin in various cellular processes, such as cell proliferation, differentiation, and migration. Additionally, this antibody has been shown to have potential therapeutic applications in cancer treatment due to its ability to inhibit the growth factor signaling pathway mediated by e-cadherin.
NOSIP antibody
The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.
EEF2 antibody
The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.
MHC class II antibody
The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.
EGFL8 antibody
EGFL8 antibody was raised using the C terminal of EGFL8 corresponding to a region with amino acids QAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS
Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Purity:Min. 95%CD56 antibody (FITC)
CD56 antibody (FITC) was raised in mouse using human CD56 as the immunogen.
Purity:Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%VMAT2 antibody
The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.
Caspase 8 antibody
The Caspase 8 antibody is a polyclonal antibody used in life sciences. It specifically targets caspase 8, a cysteine-rich protein that plays a crucial role in apoptosis (programmed cell death). This glycoprotein is an important regulator of cell survival and death pathways. The Caspase 8 antibody can be used for various applications, including western blotting, immunohistochemistry, and flow cytometry.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
