Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PHF19 antibody
PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen
Purity:Min. 95%CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
Goat anti Syrian Hamster IgG (H + L) (HRP)
Goat anti-syrian hamster IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.
SSBP3 antibody
SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP
IVD antibody
IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.
Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.SDHB antibody
The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.
PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
Desmoglein 3 antibody
Desmoglein 3 antibody was raised in mouse using recombinant human polypeptide Desmoglein 3 as the immunogen.
Podoplanin antibody
The Podoplanin antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the glial fibrillary acidic protein (GFAP), which is predominantly found in astrocytes. This antibody plays a crucial role in studying the function and behavior of astrocytes, as well as their involvement in various neurological disorders.
DCI antibody
The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.
ANGPTL3 antibody
ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen
Purity:Min. 95%ZFP36 antibody
The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.Shpk antibody
Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen
Purity:Min. 95%Complement C2 antibody
Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Purity:Min. 95%IFN gamma antibody
IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
TAZ antibody
TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.
Purity:Min. 95%CD16 antibody (Allophycocyanin)
CD16 antibody (Allophycocyanin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
