Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CD44 antibody (Spectral Red)
CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molPSENEN antibody
PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen
Purity:Min. 95%STT3B antibody
The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.
SMAD2 antibody
The SMAD2 antibody is a highly specialized Monoclonal Antibody that targets the EGF-like domain of the SMAD2 protein. It is widely used in research and bioassays to study the role of SMAD2 in various cellular processes. This antibody specifically recognizes the glial fibrillary acidic protein (GFAP), a key marker for astrocytes and reactive gliosis. It has been shown to have neutralizing activity against GFAP, making it an effective tool for studying the functions and regulation of this important glycoprotein.
SEPN1 antibody
SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen
Purity:Min. 95%Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.Ribophorin II antibody
Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
Purity:Min. 95%FBXO18 antibody
FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)Midkine antibody
The Midkine antibody is a powerful tool in Life Sciences research. Midkine is a growth factor that plays a crucial role in various biological processes, including cell proliferation, migration, and survival. It interacts with TGF-β1 and other binding proteins to regulate the activity of the erythropoietin receptor.
TPM2 antibody
The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.
Somatostatin antibody
Somatostatin antibody was raised in sheep using somatostatin conjugated to carrier protein as the immunogen.
MDFIC antibody
MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen
Purity:Min. 95%WDR5 antibody
WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen
Purity:Min. 95%GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.Mouse anti Human Kappa Light Chain antibody
Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
PNMA3 antibody
PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
Chromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
TNF alpha antibody
TNF alpha antibody was raised in Mouse using recombinant human TNF alpha as the immunogen.STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Purity:Min. 95%CD38 antibody
The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.
mGluR1 alpha antibody
mGluR1 alpha antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human GluR1 alpha protein as the immunogen.Purity:Min. 95%COL11A1 antibody
The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.
Carbonyl Reductase 1 antibody
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Goat anti Cat IgG (Texas Red)
Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%ME1 antibody
ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Purity:Min. 95%
