Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,621 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CA 50 antibody
CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.
Purity:Min. 95%GRIP1 antibody
GRIP1 antibody was raised in rabbit using the C terminal of GRIP1 as the immunogen
Purity:Min. 95%SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.GABABR2 antibody
GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.
Purity:Min. 95%PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%Goat anti Human Lambda Chain (Texas Red)
Goat anti-human lambda chain was raised in goat using human lambda light chain as the immunogen.
Purity:Min. 95%NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
TPM2 antibody
The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.
eIF2 alpha antibody
The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.
Purity:Min. 95%p73 antibody
The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%HIV1 antibody (HTLV3) (FITC)
HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.
Rabbit anti Sheep IgG (Texas Red)
Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(c) fragment as the immunogen.
Purity:Min. 95%NFS1 antibody
NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
AKR1C1 antibody
The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.
Purity:Min. 95%PPP1R12A antibody
PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen
proBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
MDM1 antibody
MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Purity:Min. 95%SMAD2 antibody
The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.
Purity:Min. 95%TSH beta antibody F(ab)'2 Fragment
TSH beta antibody was raised against Human TSH (intact).
Purity:Min. 95%H+K+ ATPase antibody
H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.
Purity:>92% By Gel Electrophoresis And Gel ScanningCytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
