Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
BAG4 antibody
<p>The BAG4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that has been extensively studied and proven to be effective in various research applications. This antibody specifically targets BAG family molecular chaperone regulator 4 (BAG4), which plays a crucial role in cell signaling and regulation.</p>SFRP4 antibody
<p>The SFRP4 antibody is a highly specialized monoclonal antibody that is designed to target and inhibit the function of secreted frizzled-related protein 4 (SFRP4). This antibody is buffered and formulated with cellulose to ensure stability and optimal performance.</p>Tau antibody
<p>The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.</p>SirT1 antibody
<p>The SirT1 antibody is a highly specialized tool used in life sciences research. It is a polyclonal antibody that specifically targets the Sirtuin 1 (SirT1) protein, which plays a crucial role in various cellular processes. This antibody can be used in a wide range of applications, including western blotting, immunohistochemistry, and immunofluorescence.</p>TBCA antibody
<p>TBCA antibody was raised in mouse using recombinant TBCA (1-108aa) purified from E. coli as the immunogen.</p>ACO2 antibody
<p>ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA</p>COPG antibody
<p>COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK</p>TNRC6B antibody
<p>TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG</p>TEK antibody
<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>EXO1 antibody
<p>The EXO1 antibody is a highly specific and sensitive polyclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to detect and target a variety of proteins, making it an essential tool in many research applications. This antibody has been extensively tested and validated, ensuring reliable and accurate results.</p>PSCA antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>XPA antibody
<p>The XPA antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to XPA, a protein involved in DNA repair. This antibody has been widely used in studies investigating the role of XPA in various cellular processes, including DNA damage response and repair mechanisms. The XPA antibody has shown high specificity and sensitivity in detecting XPA protein levels in human serum samples. It has also been used to study the interaction between XPA and other proteins, such as taxol, atrial natriuretic peptide, and growth factors. Additionally, this antibody has been used in the development of nanocomposites for drug delivery systems and as a tool for neutralizing specific proteins in monoclonal antibody-based therapies.</p>MRPL45 antibody
<p>MRPL45 antibody was raised in rabbit using the C terminal of MRPL45 as the immunogen</p>RBM22 antibody
<p>RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV</p>Tetracycline antibody
<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>Purity:≥90%
