Primary Antibodies

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.</p>

<p>Purified Polyclonal AKAP13 antibody</p>

<p>Rabbit polyclonal TMLHE antibody</p>

<p>PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR</p>

<p>Purified Polyclonal Von Hippel Lindau antibody</p>

<p>Mouse monoclonal CXorf26 antibody</p>

<p>Rabbit polyclonal RPL3 antibody</p>

<p>Rabbit polyclonal Paxillin antibody (Ser272)</p>

<p>The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.</p>

<p>Rabbit polyclonal PKC epsilon antibody (Ser729)</p>

<p>HSP60 antibody was raised in mouse using recombinant human Hsp60 (1-573aa) purified from E. coli as the immunogen.</p>

<p>Purified Polyclonal SENP7 antibody</p>

<p>RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM</p>

<p>KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>CD19 antibody was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL</p>

<p>Purified Rabbit polyclonal PRKCG antibody</p>

<p>The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>INSR antibody was raised in Rabbit using Human INSR as the immunogen</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>Mouse monoclonal SCYL3 antibody</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>