Primary Antibodies

<p>RELT antibody is a monoclonal antibody that specifically targets ferritin, a protein involved in iron homeostasis. This antibody has been shown to inhibit oxidative damage caused by ferritin and prevent the accumulation of iron in cells. In addition, RELT antibody has shown potential therapeutic effects against various diseases, including influenza hemagglutinin and fibrinogen-related disorders. It has also been found to inhibit the growth of hepatocyte growth factor-dependent tumors. This monoclonal antibody derivative works by binding to specific epitopes on ferritin and blocking its activity. By targeting ferritin at the molecular level, RELT antibody offers a promising approach for the development of targeted therapies in Life Sciences.</p>

<p>Rabbit polyclonal HRNPK antibody (Ser216)</p>

<p>Rabbit polyclonal ADH7 antibody</p>

<p>The Resistin antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of nuclear antibodies and acts as a growth factor and necrosis factor-related apoptosis-inducing protein complex. This monoclonal antibody is specifically designed to neutralize the effects of resistin, a hormone that plays a role in insulin resistance and inflammation.</p>

<p>Rabbit polyclonal MAPKAPK2 antibody</p>

<p>MIF antibody was raised in rabbit using the middle region of MIF as the immunogen</p>

<p>Alpha-fetoprotein antibody is a monoclonal antibody that inhibits the activity of alpha-fetoprotein (AFP), a protein kinase involved in various biological processes. This antibody has been shown to neutralize the superoxide produced by AFP, thereby reducing its inhibitory effect on polymers and other enzymes. In addition, alpha-fetoprotein antibody has demonstrated anticancer activity by suppressing the growth and proliferation of cancer cells. This antibody is widely used in life sciences research and has potential applications in the development of targeted therapies for various diseases, including cancer. Furthermore, it has been found to have an inhibitory effect on collagen synthesis and may have implications for tissue repair and wound healing. With its unique properties and broad range of applications, alpha-fetoprotein antibody is an essential tool for scientists and researchers in the field of antibodies and molecular biology.</p>

<p>Purified Polyclonal RPS2 antibody</p>

<p>OR2M2 antibody was raised in rabbit using the C terminal of OR2M2 as the immunogen</p>

<p>Rabbit polyclonal AML1 antibody (Ser435)</p>

<p>Purified Polyclonal EEF1B2 antibody</p>

<p>NPFF1 antibody was raised in rabbit using N terminal sequence MEGEPSQPPNSSWPLS and C terminal sequence CSHLPLTIPAWDI of the human NPFF1 protein as the immunogen.</p>

<p>FMNL2 antibody was raised in Rabbit using Human FMNL2 as the immunogen</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>Properdin antibody was raised in Mouse using Human properdin purified from blood as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Purified Rabbit polyclonal BCL2 antibody (Ser70)</p>

<p>Purified Polyclonal NDUFA4 antibody</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>Mouse monoclonal MAPK11 antibody</p>

<p>Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL</p>

<p>DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD</p>

<p>The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.</p>

<p>The Tyrosine Hydroxylase antibody is a highly specific antibody that binds to tyrosine hydroxylase, an enzyme involved in the synthesis of neurotransmitters such as dopamine and norepinephrine. This antibody is widely used in Life Sciences research to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.</p>

<p>EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>