Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,790 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
N cadherin antibody
<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>RAB39B antibody
<p>RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV</p>Purity:Min. 95%SSX1 antibody
<p>The SSX1 antibody is a monoclonal antibody that has a stimulatory effect on the beta3-adrenoceptor. It is used in hybridization studies to detect the presence of SSX1 mRNA in various tissues and cell lines. The SSX1 antibody has been shown to specifically bind to the proto-oncogene c-fos in nuclear extracts, forming a specific complex that can be detected using techniques such as immunohistochemistry or Western blotting. In addition, this antibody has been used in life sciences research to study the activated state of cells and its role in processes such as epithelial-mesenchymal transformation. The SSX1 antibody can also be used as a test substance to evaluate its effects on DNA binding activity or other cellular processes. Its efficacy has been demonstrated through various experimental techniques, including cresyl violet staining.</p>NP antibody
<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>Goat anti Rat IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Purity:Min. 95%ADRA1B antibody
<p>ADRA1B antibody was raised in rabbit using the C terminal of ADRA1B as the immunogen</p>Purity:Min. 95%SET antibody
<p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>EGLN3 antibody
<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>CDKN1B antibody
<p>The CDKN1B antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working with polymerase chain reactions (PCR) and studying various biological processes. This monoclonal antibody specifically targets CDKN1B, which is a protein involved in cell cycle regulation.</p>Synaptophysin antibody
<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>FSH antibody
<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>Purity:Min. 95%CD117 antibody
<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>Fractin antibody
<p>The Fractin antibody is a highly specialized monoclonal antibody that has neutralizing properties against androgen. It acts as an inhibitor of cytotoxic growth factors by binding to specific proteins, such as glycoproteins and chemokines. This antibody is commonly used in research settings to study the effects of these growth factors on various cell types.</p>Purity:Min. 95%ITGA6 antibody
<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>
