Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PRKAR1B antibody
<p>PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT</p>anti-Chicken IBDV Antibody Monoclonal
<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>Purity:Min. 95%PSCA antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>RBP4 antibody
<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>PAK4 antibody
<p>The PAK4 antibody is a protein that specifically targets and neutralizes the activity of PAK4. It belongs to the class of polyclonal antibodies, which are widely used in life sciences research. PAK4 is an important enzyme involved in various cellular processes, including cell migration, proliferation, and survival. The PAK4 antibody can be used in experiments to study the role of PAK4 in these processes. It can also be used as a diagnostic tool to detect the presence of autoantibodies against PAK4 in certain diseases. Additionally, monoclonal antibodies targeting PAK4 have been developed and can be used as therapeutic agents to inhibit its activity. The PAK4 antibody is available as both polyclonal and monoclonal forms, and it has been extensively validated for its specificity and efficacy.</p>SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Purity:Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Purity:Min. 95%HIV1 gp41 antibody (biotin)
<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>ETFB antibody
<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>WASF3 antibody
<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>MPS1 antibody
<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>ARSA antibody
<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>STAT2 antibody
<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>ITGA6 antibody
<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>
