Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CKMM antibody
CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
HSPA4 antibody
HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purity:Min. 95%MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.
CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
IRX6 antibody
IRX6 antibody was raised in rabbit using the C terminal of IRX6 as the immunogen
Purity:Min. 95%AGXT2L1 antibody
AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT
FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE
ALOX15 antibody
ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLPurity:Min. 95%NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.
Purity:Min. 95%HHIPL1 antibody
HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen
Purity:Min. 95%SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.
NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
Desmoplakin 1+2 antibody
Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.
RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purity:Min. 95%GRK6 antibody
The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.
IL10 antibody
IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.
Rabbit anti Rat IgG (H + L) (HRP)
Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.
Purity:Min. 95%SHARPIN antibody
SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen
Purity:Min. 95%EPHA3 antibody
The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
AIFM3 antibody
AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
