Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
Goat anti Monkey IgG (FITC)
Goat anti-monkey IgG (FITC) was raised in goat using monkey IgG as the immunogen.
Peripherin antibody
Peripherin antibody is a polyclonal antibody that specifically targets and neutralizes interleukin, a key player in various immune responses. This antibody is highly effective in blocking the activity of interleukin and can be used in research and diagnostic applications. The colloidal nature of this antibody allows for easy and efficient binding to target molecules, ensuring accurate and reliable results. In addition to its neutralizing properties, peripherin antibody has been shown to inhibit the signaling pathway involving β-catenin, a protein involved in cell adhesion and growth regulation. This makes it a valuable tool for studying the role of β-catenin in various biological processes. Furthermore, this antibody has been successfully used in studies involving helicobacter growth factor and epidermal growth factor, further highlighting its versatility in different research areas. With its high specificity and affinity, peripherin antibody is an essential component for any life sciences laboratory or research facility.
MALT1 antibody
The MALT1 antibody is a highly specialized and immobilized antibody that plays a crucial role in various biological processes. It is particularly effective in detecting and targeting the activated form of interferon-gamma (IFN-gamma), which is an essential antigen involved in immune response regulation. Additionally, this antibody has been shown to interact with growth factors and participate in sumoylation, a process that modifies proteins for specific cellular functions.
ERBB4 antibody
ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Vimentin protein antibody
The Vimentin protein antibody is a powerful tool for conducting antigen-antibody reactions in various research applications. This antibody specifically targets the vimentin protein, which plays a vital role in maintaining cell structure and integrity. It can be used to study vimentin expression levels, localization, and interactions with other proteins.
MVD antibody
The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.
Androgen Receptor antibody
Androgen receptor antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E V Q L G L G R V Y P R P P S K T Y R G(21) C of human androgen receptor as the immunogen.
Purity:Min. 95%A4GALT antibody
A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
Purity:Min. 95%CD22 antibody (Spectral Red)
CD22 antibody (Spectral Red) was raised in rat using CD22 as the immunogen.
Purity:Min. 95%FAM135B antibody
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
TAPBP antibody
TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
Purity:Min. 95%SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.SUV39H1 antibody
The SUV39H1 antibody is a high-quality polyclonal antibody that specifically targets the SUV39H1 protein. This protein is a histone methyltransferase that plays a crucial role in gene regulation and chromatin organization. The SUV39H1 antibody is designed to detect and bind to the activated form of SUV39H1, making it an essential tool for researchers studying epigenetics and gene expression.
STAT2 antibody
The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.
TIMP3 antibody
The TIMP3 antibody is a monoclonal antibody that targets the tissue inhibitor of metalloproteinase 3 (TIMP3). TIMP3 plays a crucial role in regulating endothelial growth and inhibiting the activity of metalloproteinases, which are enzymes involved in tissue remodeling. This antibody specifically binds to TIMP3 and can be used for various research purposes in the field of life sciences.
CD90.2 antibody (Azide Free)
CD90.2 antibody (Azide free) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
Purity:Min. 95%Fenitrothion antibody
The Fenitrothion antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to fenitrothion, a commonly used organophosphate insecticide. This antibody can be utilized for various applications, including immunoassays, Western blotting, and immunohistochemistry.
SREBF2 antibody
SREBF2 antibody was raised in rabbit using the middle region of SREBF2 as the immunogen
VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
GPR18 antibody
The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.
FH antibody
FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.
CD5 antibody (PE)
CD5 antibody (PE) was raised in rat using CD5/Lyt-1 as the immunogen.
Purity:Min. 95%Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.
Purity:Min. 95%PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE
ABCC11 antibody
ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Purity:Min. 95%Pyruvate Kinase antibody
The Pyruvate Kinase antibody is a highly specialized monoclonal antibody that targets the pyruvate kinase enzyme. This antibody has been extensively studied in the field of Life Sciences and has shown significant potential for use in various applications. It exhibits cytotoxic activity against cancer cells, making it a promising candidate for targeted therapies. Additionally, this antibody has been found to interact with fibronectin, collagen, and other glycoproteins, indicating its potential role in cell adhesion and migration processes. Furthermore, studies have demonstrated that the Pyruvate Kinase antibody can modulate the production of interleukin-6 and activate the p38 MAPK pathway. With its unique properties and versatility, this antibody holds great promise for further research and development in the fields of oncology, immunology, and drug discovery.
Na+ Ca2+ Exchanger antibody (cardiac)
Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
