Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
FKBP8 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
VDAC1 antibody
The VDAC1 antibody is a highly specialized monoclonal antibody that specifically targets the plasminogen receptor, histidine. This neutralizing antibody has been extensively studied and proven to effectively inhibit the binding of plasminogen to its receptor, thereby preventing the activation of plasminogen into plasmin. By blocking this crucial step in the plasminogen activation cascade, the VDAC1 antibody has shown great potential in various therapeutic applications.
Collagen 2 antibody
The Collagen 2 antibody is a highly specific monoclonal antibody that targets collagen, an essential protein found in connective tissues. This antibody is derived from human serum and has been extensively studied in the field of Life Sciences. It has shown to be effective in detecting collagen in various research applications.
Carbonyl Reductase 1 antibody
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
EXOSC3 antibody
EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
MAP3K15 antibody
MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
Phytase antibody
Phytase antibody is a monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. It has been shown to reduce microvessel density and inhibit the growth of blood vessels in tumors. This antibody specifically binds to sclerostin, a protein involved in bone metabolism, and has been found to increase bone mineral density. Additionally, phytase antibody has shown potential as a therapeutic agent for various diseases such as cancer and autoimmune disorders by targeting chemokines, collagen, alpha-fetoprotein, and interleukins. Its cytotoxic effects make it a promising candidate for targeted cancer therapy.NOB1 antibody
The NOB1 antibody is a cytotoxic antibody-drug that specifically targets the tyrosine residues in the nuclear region of cells. This antibody has been shown to inhibit the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, by binding to its cell surface antigen. Additionally, the NOB1 antibody has hemagglutinin activity and can bind to alpha-gal and transferrin receptors on cells. The glycosylation of this antibody enhances its stability and prolongs its half-life in circulation. This product is widely used in life sciences research and is available as polyclonal antibodies for various applications. With its high specificity and potency, the NOB1 antibody is an essential tool for studying cellular processes and immune responses.
STAT1 antibody
The STAT1 antibody is a glycopeptide that specifically targets and binds to the STAT1 protein. It is used in various research applications, including the detection and quantification of autoantibodies. The STAT1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.
CATSPER2 antibody
CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
PPP1R12A antibody
PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen
ANGPTL4 antibody
The ANGPTL4 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and neutralizes ANGPTL4, a human enzyme involved in plasma lipoprotein metabolism. This antibody can be used for various applications such as collagen polymerase chain reaction (PCR) hybridization, studying the role of ANGPTL4 in plasma lipoprotein regulation, and developing new therapeutic strategies for metabolic disorders.
SFTPD antibody
The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.
Pseudorabies Virus antibody
Pseudorabies Virus antibody is a vital tool in the field of Life Sciences. It is a polyclonal antibody that can be used for various applications. This antibody specifically targets the Pseudorabies Virus, which is a highly contagious viral disease that affects animals, especially pigs. The Pseudorabies Virus antibody can be used in research studies to detect and quantify the presence of the virus in samples.
MYST1 antibody
MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.
beta Amyloid antibody
The beta Amyloid antibody is a polyclonal antibody used in life sciences research. It specifically targets the beta amyloid protein, which plays a crucial role in the development of Alzheimer's disease. This antibody can be used for various applications such as immunohistochemistry and nuclear staining. By binding to the beta amyloid protein, this antibody helps researchers study its distribution and localization within cells and tissues. Additionally, it can be used as a potential medicament for targeting beta amyloid in therapeutic interventions. The beta Amyloid antibody is highly specific and exhibits strong affinity towards its target, making it an essential tool for studying the pathogenesis of Alzheimer's disease and developing novel treatment strategies.
BD1 antibody
BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.
Purity:Min. 95%PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Purity:Min. 95%SERPINE1 antibody
SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMPurity:Min. 95%Rotavirus antibody
Rotavirus antibody was raised in mouse using p42 inner-capsid rotavirus antigen as the immunogen.
VAV1 antibody
The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.
ND2 antibody
The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.
LBP antibody
The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
