Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
THC antibody
The THC antibody is a highly specific monoclonal antibody that is used for the detection of delta-9-tetrahydrocannabinol (THC). It is derived from hybridoma cells and has been extensively tested for its accuracy and reliability. The antibody is buffered and can be used with human serum samples.eNOS antibody
The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.
ApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.
PARP11 antibody
PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
Cartilage associated protein antibody
Affinity purified Rabbit polyclonal Cartilage associated protein antibody
ZHX2 antibody
The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.
SYN1 antibody
The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.
Aminoacylase 1 antibody
The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.
Spermidine synthase antibody
The Spermidine synthase antibody is a monoclonal antibody that specifically targets the tyrosine residue in interleukin-6 (IL-6). It is a highly specific and sensitive tool used in Life Sciences research to detect and quantify IL-6 levels in various biological samples. This antibody has been extensively validated for its specificity, sensitivity, and reproducibility.
IL4 antibody
The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.
Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.Calretinin antibody
The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.
GHR antibody
The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.
ApoH antibody (HRP)
ApoH antibody (HRP) was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.
GAD65 antibody
GAD65 antibody is a polyclonal antibody that is commonly used in Life Sciences research. This antibody specifically targets the enzyme glutamate decarboxylase 65 (GAD65). GAD65 plays a crucial role in the synthesis of gamma-aminobutyric acid (GABA), an inhibitory neurotransmitter in the central nervous system. The cytotoxic effects of GAD65 antibodies have been studied in various research models, including androgen-treated prostate cancer cells, where it was found to inhibit cell proliferation and induce apoptosis.
CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
BRCA1 antibody
The BRCA1 antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results in various experiments, including phorbol-induced differentiation and interferon-mediated signaling pathways. This monoclonal antibody has been used for neutralizing experiments, electrophoresis, and as an electrode in various research studies. The BRCA1 antibody is produced using a state-of-the-art lyophilization method to ensure its stability and efficacy. It is also available as an anticoagulant for specific applications. This antibody is highly specific and can be used to detect autoantibodies or as a tool for studying the expression of BRCA1 protein in different tissues.
IRF2BP1 antibody
IRF2BP1 antibody was raised using the middle region of IRF2BP1 corresponding to a region with amino acids LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ
PDE4D antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
ApoE antibody
Apolipoprotein E antibody was raised in mouse using human apolipoprotein E as the immunogen.
APE1 antibody
The APE1 antibody is a highly specific monoclonal antibody that targets endoplasmic reticulum aminopeptidase 1 (APE1). It is used in Life Sciences research to study the role of APE1 in various cellular processes. This antibody has been shown to neutralize the activity of APE1, which is involved in DNA repair and redox regulation. It can be used for immunoprecipitation, Western blotting, and immunofluorescence experiments. The APE1 antibody has been validated using mass spectrometric methods and has been shown to specifically recognize APE1 in nuclear extracts. It can also be immobilized on an electrode for use in electrochemical assays. With its high specificity and versatility, the APE1 antibody is an essential tool for researchers studying growth factors, signal transduction pathways, and DNA repair mechanisms.
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a highly specialized antibody that targets the phosphatase enzyme. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of phosphatase activity in biological samples. It can also be used to study the role of phosphatases in signaling pathways, cell differentiation, and disease progression.
Annexin A1 antibody
The Annexin A1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various cellular processes, including hepatocyte growth, epidermal growth factor signaling, and TGF-beta regulation. This antibody has been shown to neutralize the effects of growth factors such as transferrin and promote cellular homeostasis. With its high specificity and affinity for Annexin A1, this antibody can effectively bind to the protein and modulate its activity.
TH antibody
TH antibody is a monoclonal antibody that targets the growth factor known as epidermal growth factor (EGF). It specifically binds to EGF and inhibits its activity, making it an effective tool for research in the field of Life Sciences. This antibody has been used in various studies to investigate the role of EGF in different biological processes. Additionally, TH antibody has shown neuroprotective properties by reducing dopamine levels in the brain. It can be used in experiments involving electrode recordings or binding protein analysis. Whether you're studying cell signaling pathways or developing new therapeutic approaches, TH antibody is a valuable tool for your research.
NODAL antibody
NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
IL4 antibody
The IL4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes interleukin-4 (IL-4), a glycan involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications.
STT3B antibody
The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.
Rat anti Mouse IgA (biotin)
Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.
Filamin B antibody
The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.
RALY antibody
RALY antibody was raised using the C terminal of RALY corresponding to a region with amino acids GGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDT
ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
