Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Annexin A3 antibody
Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
PSME3 antibody
PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Fascin antibody
Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.
FMO2 antibody
The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.
Troponin I antibody
The Troponin I antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize Troponin I, a glycoprotein involved in muscle contraction. This antibody has been extensively studied and proven to have high affinity and specificity for Troponin I.ADRB3 antibody
The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.
HIV1 gp41 antibody (biotin)
HIV1 gp41 antibody (biotin) was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.CDKL3 antibody
The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.
Neu antibody
Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.
Staphylococcus aureus antibody (biotin)
Staphylococcus aureus antibody (biotin) was raised in rabbit using ATCC 27660 as the immunogen.Fractalkine antibody
Fractalkine antibody is an antigen-specific antibody that targets the chemokine known as fractalkine. It is commonly used in Life Sciences research and is available in both polyclonal and monoclonal forms. This antibody has the ability to bind to fractalkine, leading to lysis or cross-linking of the target molecule. The activated antibody can also be used as a neutralizing agent against extracellular polysaccharides. Fractalkine antibody is widely used in various applications, including immunohistochemistry, flow cytometry, and Western blotting, to study the role of fractalkine in different biological processes. With its high specificity and affinity for fractalkine, this antibody provides researchers with a valuable tool for investigating the functions and mechanisms of this important chemokine in various contexts.
MTA1 antibody
The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
Beta Lactoglobulin antibody
The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.
HSV1 + HSV2 antibody (biotin)
HSV1/HSV2 antibody (biotin) was raised in rabbit using Strain F as the immunogen.NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA
GABRB2 antibody
GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR
CCR10 antibody
The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.
Kaptin antibody
Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL
BAK1 antibody
The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.
Tropomyosin 1 antibody
Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE
PINX1 antibody
The PINX1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and neutralizes the PINX1 protein. This protein is found in various tissues, including liver microsomes, and plays a role in regulating important cellular processes such as dopamine signaling, oncostatin production, and β-catenin localization within the nucleus.
AKR1C1 antibody
AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.
HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesCDC2 antibody
The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.
GAPDH antibody
The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
IBSP antibody
IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE
N Cadherin antibody
The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.
K2 antibody
The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.
RG9MTD2 antibody
RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.Collagen Type II antibody
Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.
Thrombospondin antibody
Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.
RGS20 antibody
RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
