Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
RGS2 antibody
The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.
Goat anti Monkey IgG
Goat anti-monkey IgG was raised in goat using monkey IgG gamma chain as the immunogen.Purity:Min. 95%Caspase 1 antibody
The Caspase 1 antibody is a highly effective tool for immunoassays and research purposes. This antibody specifically targets caspase 1, a key enzyme involved in inflammatory responses and cell death. It has been shown to neutralize the activity of caspase 1, making it an essential component for studies related to fibronectin, insulin, collagen, β-catenin, and other growth factors.
YTHDF1 antibody
The YTHDF1 antibody is a highly specialized monoclonal antibody that targets the YTH domain family protein 1 (YTHDF1). This peptide system plays a crucial role in various biological processes, including RNA metabolism and translation regulation. The YTHDF1 antibody is designed to specifically bind to YTHDF1 and neutralize its activity.
Carbonyl Reductase 1 antibody
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
MAP3K15 antibody
MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
SLC5A4 antibody
SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%SFTPD antibody
The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.
MMAB antibody
The MMAB antibody is an activated Monoclonal Antibody that is commonly used in Life Sciences research. It specifically targets insulin, a hormone involved in regulating blood sugar levels. This antibody can be used for various applications, including immunohistochemistry and the detection of interleukin-6 (IL-6) levels. The MMAB antibody has cytotoxic properties, meaning it can selectively kill cells expressing the target protein. Additionally, it has been shown to interact with other proteins such as butyrylcholinesterase, TRPV4, and actin. With its high specificity and affinity for its target, the MMAB antibody is a valuable tool for studying insulin-related processes and their implications in various diseases and disorders.NEDD1 antibody
NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
Semenogelin I antibody
Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
TIP47 antibody
TIP47 antibody was raised in guinea pig using synthetic peptide of TIP47 N-terminus as the immunogen.
Purity:Min. 95%SMAD2 antibody
The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.
Purity:Min. 95%AML1 antibody
The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.
Akt antibody
Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.
STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Purity:Min. 95%CO1 antibody
The CO1 antibody is a monoclonal antibody that specifically targets and neutralizes the CO1 protein. This protein is involved in various biological processes, including the regulation of brain natriuretic peptide levels and interferon production. The CO1 antibody has been extensively studied in Life Sciences research and has shown promising results as an antiviral agent. It can be used in laboratory experiments to study the function of the CO1 protein or as a potential therapeutic option for certain diseases. The CO1 antibody is formulated with high-quality excipients to ensure stability and efficacy. Additionally, polyclonal antibodies are also available for researchers who require a broader range of target recognition. Trust the CO1 antibody for reliable and accurate results in your scientific endeavors.
C5 antibody
The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.
Arginase I antibody
The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.
OCT3 antibody
The OCT3 antibody is a monoclonal antibody that specifically targets and binds to the organic cation transporter 3 (OCT3). This antibody has been extensively studied and shown to have a high affinity for OCT3, making it a valuable tool for research in the field of life sciences.
Mouse Macrophage antibody (FITC)
Mouse macrophage antibody (FITC) was raised in rabbit using mouse macrophages as the immunogen.CD4 antibody
The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.
DDT antibody
The DDT antibody is a monoclonal antibody that belongs to the globulin class of antibodies. It is specifically designed for use in Life Sciences research and has neutralizing properties against the DDT antigen. This antibody can effectively bind to and inhibit the activity of DDT, a toxic chemical compound widely used as an insecticide.
AMPK alpha antibody
The AMPK alpha antibody is a high-quality polyclonal antibody that is used in life sciences research. It specifically targets AMP-activated protein kinase (AMPK) alpha subunit and can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation.
AFP antibody
The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.
AND1 antibody
AND1 antibody was raised in mouse using Nuclear fraction prepared from Xenopus laevis oocytes as the immunogen.L1CAM antibody
The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.
IL8 antibody
The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.
KLK5 antibody
The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.
Human Nuclei antibody
The Human Nuclei antibody is a monoclonal antibody that specifically targets the nuclei of human cells. It recognizes sugar moieties on nuclear proteins and can be used for various applications in life sciences research. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection of human nuclei in tissue samples.
S100P antibody
The S100P antibody is a powerful tool used in the field of Life Sciences. It is an essential component in various laboratory techniques such as hybridization, polymerase chain reaction (PCR), and particle chemiluminescence. This polyclonal antibody specifically targets cytochrome P450 oxidoreductase, which plays a crucial role in drug metabolism and detoxification processes.
FBXO5 antibody
FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
AQP1 antibody
The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.
Phosphotyrosine antibody
The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.
Purity:Min. 95%Goat anti Human IgE (epsilon chain) (biotin)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%SH3RF1 antibody
SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG
MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
ETV1 antibody
ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen
Purity:Min. 95%Caspase 7 antibody
The Caspase 7 antibody is a powerful inhibitory factor used in Life Sciences research. This polyclonal antibody specifically targets the protein caspase 7, which plays a crucial role in programmed cell death (apoptosis). By blocking the activity of caspase 7, this antibody allows researchers to investigate its function and explore its potential as a therapeutic target.
Prothrombin factor II antibody (HRP)
Prothrombin factor II antibody (HRP) was raised in sheep using human Prothrombin purified from plasma as the immunogen.DDX50 antibody
DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
