Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Fibrinogen antibody
Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.Purity:Min. 95%AHCY antibody
AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA
IL6 antibody
IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.
TUSC4 antibody
TUSC4 antibody was raised in rabbit using the middle region of TUSC4 as the immunogen
Purity:Min. 95%Legionella pneumophila antibody (HRP)
Legionella pneumophila antibody (HRP) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.Bax antibody
The Bax antibody is a chemokine globulin that is used in Life Sciences for its antiviral properties. It contains neutralizing antibodies that bind to specific proteins and colony-stimulating factors, such as GM-CSF (granulocyte-macrophage colony-stimulating factor). This polyclonal antibody has been activated and is a potent growth factor. It is formulated with excipients to ensure stability and effectiveness. The Bax antibody is commonly used in research and diagnostic applications to study cellular processes and immune responses.
CD154 antibody (PE)
CD154 antibody (FITC) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.
Purity:Min. 95%pan Cytokeratin antibody
pan Cytokeratin antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 5 expressed in E. coli as the immunogen.GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.Methcathinone Antibody
The Methcathinone Antibody is a highly specialized antibody that exhibits insulin-like properties and interferes with the function of specific antigens. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to effectively bind to recombinant proteins, growth factors, interleukins, and IFN-gamma, inhibiting their activity and preventing their interaction with target receptors. Additionally, this antibody has been immobilized on activated fatty acids, allowing for easy purification and isolation of target molecules. With its unique tyrosine-based structure, the Methcathinone Antibody offers a valuable tool for researchers in need of a reliable and efficient method for studying sumoylation processes and investigating the role of specific antigens in cellular functions.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%Archain 1 antibody
Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT
Phospholamban antibody
The Phospholamban antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and neutralize phospholamban, an inhibitory factor involved in the regulation of calcium uptake and release in cardiac muscle cells. This antibody has been extensively tested and shown to effectively lyse phospholamban-expressing cells, making it a valuable tool for researchers studying the role of phospholamban in various physiological processes. Additionally, this antibody has also been found to have neutralizing effects on certain autoantibodies, such as antiphospholipid antibodies, and can modulate the activity of colony-stimulating factors like GM-CSF. With its high specificity and potency, the Phospholamban antibody is an essential component for any research project involving phospholamban or related proteins.
p21 antibody
The p21 antibody is a chemokine that is widely used in immunoassays. It belongs to the class of polyclonal antibodies and is commonly used as a medicament in various applications. This antibody has been shown to have reactive and neutralizing properties, making it highly effective in targeting specific antigens. It is often used in research involving mesenchymal stem cells and cardiomyocytes, where it plays a crucial role in studying their functions and interactions. The p21 antibody is also used in the detection and measurement of various substances, such as steroids and recombinant antigens, through antigen-antibody reactions. In the field of Life Sciences, this antibody is an essential tool for researchers conducting experiments involving polymerase chain reactions, acetylcholine signaling, and the study of autoantibodies. With its versatility and reliability, the p21 antibody is an invaluable asset for scientists seeking to advance their understanding of cellular processes and develop innovative medical solutions.
HDAC3 antibody
The HDAC3 antibody is a highly specialized antibody that targets the hydroxyl groups on specific proteins. It is designed to neutralize the reactive properties of these proteins, particularly c-myc. This antibody has been extensively studied in the field of Life Sciences and is widely recognized for its efficacy. It is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. The HDAC3 antibody has also shown promising results as a protein-coupled therapeutic agent, with potential applications in cytotoxicity and inhibition of bace1 activity. Additionally, it has been found to reduce the production of reactive oxygen species, making it a valuable tool in oxidative stress research. Whether you are conducting basic research or developing new therapies, the HDAC3 antibody is an essential component of your toolkit.
TACC3 antibody
The TACC3 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets TACC3, which stands for transforming acidic coiled-coil-containing protein 3. TACC3 is involved in cell division, growth regulation, and development.
Helicobacter pylori antibody (HRP)
Helicobacter pylori antibody (HRP) was raised in rabbit using ATCC strain 43504 as the immunogen.Goat anti Human IgM (HRP)
Goat anti-human IgM (HRP) was raised in goat using human IgM mu heavy chain as the immunogen.
Purity:Min. 95%MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
TFE3 antibody
The TFE3 antibody is a polyclonal antibody that specifically targets the beta-hairpin region of the TFE3 protein. This antibody is widely used in life sciences research, particularly in assays related to growth factors, insulin, and inhibitors. The TFE3 antibody has been shown to effectively detect and neutralize superoxide, making it a valuable tool for studying oxidative stress-related processes. Additionally, this antibody has demonstrated cytotoxic effects against cancer cells expressing high levels of c-myc and endothelial growth factors. Researchers also utilize the TFE3 antibody in anti-VEGF and erythropoietin studies. With its versatility and reliability, the TFE3 antibody is an essential component for various experiments in the field of life sciences.
PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Lamin Type A and C antibody
Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
LECT2 antibody
The LECT2 antibody is a highly specific monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to LECT2 (leukocyte cell-derived chemotaxin 2), a protein found in human serum. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.ADAM17 antibody
The ADAM17 antibody is a monoclonal antibody that specifically targets ADAM17, also known as tumor necrosis factor-alpha converting enzyme (TACE). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
Actin antibody
Actin antibody was raised in mouse using Profilin actin complex from calf thymus as the immunogen.Goat anti Mouse IgM (mu chain) (HRP)
This antibody reacts with heavy (mu) chains on mouse IgM and light chains on all mouse immunoglobulins.Purity:Min. 95%Urocortin antibody
The Urocortin antibody is a polyclonal antibody that specifically targets the cleavage products of the human protein, Urocortin. This antibody is widely used in life sciences research and has applications in various fields such as gel chromatography and staining. It can also be used as an inhibitor of urokinase-type plasminogen activator and corticotropin-releasing hormone receptor. Additionally, this antibody has shown potential for clinical use, particularly in the development of therapeutic antibodies or synthetic peptides targeting Urocortin and related proteins. With its high specificity and versatility, the Urocortin antibody is an essential tool for researchers in need of reliable detection and analysis of Urocortin-related biomarkers.
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
IL10 antibody
The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.
CAMKII antibody
The CAMKII antibody is a powerful tool in the field of Life Sciences. It is an essential component for various experiments and research studies. This antibody can be used in conjunction with electrodes to study the effects of different factors on cellular processes. The CAMKII antibody specifically targets and binds to proteins involved in cell signaling, such as epidermal growth factor and endothelial growth factor receptors.
ALDH3B1 antibody
ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD
CD102 antibody (PE)
CD102 antibody (PE) was raised in rat using COS cells transfected with mouse ICAM-2 cDNA as the immunogen.
Purity:Min. 95%CDC42 antibody
The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.
MVP antibody
MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
CD69 antibody (biotin)
CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
Purity:Min. 95%SERPINA1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
JAK1 antibody
The JAK1 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Janus kinase 1 (JAK1) protein, which plays a crucial role in various cellular processes including immune response and cell growth. By inhibiting the activity of JAK1, this antibody has antiviral properties and can be used for research purposes in studying viral infections.
BAG3 antibody
BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Purity:Min. 95%ALDH1A2 antibody
The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.
NOTCH1 antibody
The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.
IFI35 antibody
IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL
HRP antibody
The HRP antibody is a highly sought-after product in the field of Life Sciences. It is available as both a monoclonal antibody and polyclonal antibodies. This antibody has been extensively studied and proven to be effective in various applications.Purity:Min. 95%RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
