Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Lp-PLA2 polyclonal antibody
Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2) polyclonal Antibody
Purity:Min. 95%CD80 antibody
The CD80 antibody is a highly effective and versatile tool in the field of Life Sciences. This monoclonal antibody has a colloidal structure that allows it to efficiently bind to collagen and other target molecules. It is commonly used in research and diagnostic applications, particularly in the study of TGF-beta signaling pathways.
CIAPIN1 antibody
The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.
Lamin Type A and C antibody
Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.
ATG16L1 antibody
ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA
Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
DPY19L4 antibody
DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR
Purity:Min. 95%TGF beta 2 antibody
TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Purity:Min. 95%TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
C20ORF3 antibody
C20ORF3 antibody was raised using the N terminal Of C20Orf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK
Purity:Min. 95%YBX1 antibody
The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.
CD11b antibody (Spectral Red)
CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Purity:Min. 95%ALDH3B1 antibody
ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD
Goat anti Rabbit IgG (FITC)
Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Alk Phos)
Goat anti-rabbit IgG (H + L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.Purity:Min. 95%Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.
PGK1 antibody
PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR
C20ORF144 antibody
C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ
TMEM158 antibody
TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Purity:Min. 95%KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
proGRP antibody
The proGRP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and immobilize the proGRP protein, which plays a crucial role in various biological processes. This antibody is produced using both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity.
ACTRT1 antibody
ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
CD45 antibody (FITC)
CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
CD44 antibody (Spectral Red)
CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in rat using CD3e as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molPFKL antibody
The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.
COL4A3 antibody
COL4A3 antibody is a high-quality antibody used in Life Sciences research. It is specifically designed to target and bind to the COL4A3 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its specificity and sensitivity.
IL6 antibody
The IL6 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a key growth factor involved in various physiological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of IL-6.CD19 antibody (PE-CY7)
CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molUCP2 antibody
UCP2 antibody was raised in rabbit using a 14 amino acid peptide from mouse UCP2 as the immunogen.Purity:Min. 95%DYSF antibody
DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNEPurity:Min. 95%TRNT1 antibody
TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Streptococcus Group B antibody (biotin)
Streptococcus group B antibody (biotin) was raised in rabbit using group B Streptococci as the immunogen.DECR1 antibody
The DECR1 antibody is a highly specialized peptide agent used in Life Sciences research. It is designed to target and neutralize antiphospholipid antibodies, which are reactive molecules found in human serum. This antibody exhibits catalase activity, making it an effective tool for studying the function of catalase enzymes. Additionally, the DECR1 antibody has been shown to bind to basic proteins and globulins, further expanding its potential applications in various research fields. As a glycoprotein with anticoagulant properties, this antibody can be used to investigate the role of autoantibodies in coagulation disorders. Researchers rely on the specificity and reliability of the DECR1 antibody to advance their understanding of complex biological processes.
SAE1 antibody
The SAE1 antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets the SAE1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying SAE1 protein levels.
STAT5A antibody
The STAT5A antibody is a highly effective medicament that targets the STAT5A protein, a key player in various cellular processes. This antibody specifically binds to STAT5A and inhibits its activity, leading to a decrease in TGF-beta signaling and reduced microvessel density. The use of this antibody has shown promising results in blocking IL-17A-induced inflammation and has been used as a research tool to study the role of STAT5A in oncogenic kinase signaling pathways. Additionally, this antibody can be used for immunohistochemistry and Western blotting to detect and quantify STAT5A protein levels in cells and tissues. With its high specificity and sensitivity, this monoclonal antibody is an indispensable tool for researchers studying growth factors, messenger RNA regulation, and protein inhibitors.
Factor VIIIc antibody
Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.
RXRB antibody
The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.
HES2 antibody
The HES2 antibody is a polyclonal antibody that specifically targets the serum albumin protein. It has cytotoxic properties and is widely used in Life Sciences research. The HES2 antibody has been shown to interact with various proteins, including angptl3, e-cadherin, taxol, β-catenin, and osteopontin. It is commonly used in experiments involving hybridization and activated human serum. This antibody is highly effective in detecting and analyzing specific proteins in biological samples, making it an essential tool for researchers in various fields.
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
