Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Anti-PSG1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-C6 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-DEFB104A Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-RAET1E Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CXCL2 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-IGFBP6 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM, IF<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-PRL Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-EPGN Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-AGA Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CD38 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-GNRH2 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CD83 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-IFNA17 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-AOAH Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-RAMP1 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-SFTPB Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-PTGDS Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-KLK8 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-IL2RG Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CD200 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-EMB Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-TGFBR2 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-KIRREL1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-AFP Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-DLK1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-REG1B Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-AHSG Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CEACAM7 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-C6 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-KIR2DL1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CXCL2 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-RNASE3 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-BAM Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-IL1R1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-NECTIN4 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-BTN1A1 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-IL6ST Monoclonal Antibody
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM, IF<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CRLF2 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CA9 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-OSM Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-EFNB2 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-SLAMF6 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CD68 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-TNFRSF1B Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-PRG2 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-FSTL1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-JAM3 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-PRG2 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CTSB Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-NPTN Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal<br>
Application: FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-TFF1 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CCL16 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-TMEM25 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-TNFRSF18 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM,IF
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CSF3 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-PDPN Monoclonal Antibody
Antibody Type: Rabbit Monoclonal<br>
Application: ELISA, FCM<br>
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-CD82 Monoclonal Antibody-Biotin
Antibody Type: Rabbit Monoclonal
Application: ELISA,FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaAnti-ACRV1 Monoclonal Antibody
Antibody Type: Rabbit Monoclonal
Application: FCM
Reactivity: HumanPurity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaDaratumumab
CAS:Daratumumab is a human monoclonal antibody that targets CD38 a cell surface protein that is overexpressed on multiple myeloma MM) cells.Purity:98.50% - 98.60%Color and Shape:LiquidMolecular weight:145.26 kDaB7/CD28 interaction inhibitor 1
CAS:B7/CD28 interaction inhibitor 1 (CTLA-4 inhibitor) is a potent CTLA-4 inhibitor.Formula:C21H13F4N5OPurity:99.5% - 99.63%Color and Shape:SolidMolecular weight:427.35Ref: TM-T3189
1mg80.00€2mg107.00€5mg173.00€10mg281.00€25mg520.00€50mg745.00€100mg982.00€1mL*10mM (DMSO)192.00€Tocilizumab
CAS:Tocilizumab (Anti-Human IL6R) is a neutralizing antibody against human interleukin-6 receptor (IL-6R) that blocks the binding of IL-6 to IL-6R.Cost-effective and quality-assured.Purity:98% - 99.50%Color and Shape:LiquidMolecular weight:145.2 kDaClostridium difficile toxin B antibody
Clostridium difficile toxin B antibody is a monoclonal antibody that specifically targets and neutralizes the Clostridium difficile toxin B. This antibody belongs to the group of antibodies known as anti-CD33 antibodies, which have been shown to have a stimulatory effect on immune cells and can induce apoptosis in certain cell types. The monoclonal antibody recognizes a specific epitope on the Clostridium difficile toxin B glycoprotein, preventing its binding to host cells and subsequent protease activity. This antibody has been extensively studied in Life Sciences research and has shown promising results in preclinical models. It may have potential applications in the development of therapeutic interventions against Clostridium difficile infections.BRRN1 antibody
BRRN1 antibody was raised in mouse using recombinant Human Non-Smc Condensin I Complex, Subunit H (Ncaph)PPAR δ antibody
PPAR Delta antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) E Q P Q E E T P E A R E E(14) C of mouse PPAR delta.Purity:Min. 95%EBV antibody
EBV antibody was raised in mouse using p120 and p160 capsid antigen of EBV as the immunogen.IL12 antibody
IL12 antibody was raised in goat using highly pure recombinant human IL12human as the immunogen.
Osteocalcin antibody
The Osteocalcin antibody is a highly specific monoclonal antibody that targets osteocalcin, a protein involved in bone formation and regulation. This antibody is widely used in Life Sciences research to study the role of osteocalcin in various physiological processes.Metapneumovirus antibody
Metapneumovirus antibody was raised in mouse using matrix protein of human metapneumovirus as the immunogen.Mouse PMN antibody
Mouse PMN antibody was raised in rabbit using mouse PMNs as the immunogen.
Purity:Min. 95%Staphylococcus aureus antibody
Staphylococcus aureus antibody was raised in mouse using staphylococcus aureus as the immunogen.CRP antibody
CRP antibody was raised in sheep using human CRP purified from acute phase sera as the immunogen.Purity:Min. 95%Human Growth Hormone antibody
The Human Growth Hormone antibody is a powerful tool used in immunoassays and research in the field of Life Sciences. This Monoclonal Antibody specifically targets Human Growth Hormone, binding to it with high affinity and specificity. It can be used for various applications, including the detection and quantification of Human Growth Hormone levels in biological samples.HBsAg antibody
HBsAg antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It specifically targets the virus surface antigen (HBsAg) and acts as a neutralizing agent, preventing the virus from infecting healthy cells. This antibody is produced using advanced techniques and high-quality excipients to ensure its efficacy and safety. HBsAg antibody has been extensively tested and proven to be highly specific, binding only to the target antigen without cross-reactivity with other molecules. Its cytotoxic effect on infected cells makes it a valuable tool in research and diagnostic applications. Additionally, this antibody is available in various formats, including histidine-tagged versions for easy purification and detection. Trust HBsAg antibody to provide accurate and reliable results in your experiments or assays related to viral infections and immune response.FSH antibody
The FSH antibody is a monoclonal antibody that has the ability to specifically bind to follicle-stimulating hormone (FSH). This antibody can be used for various applications, including lysis of FSH-producing cells and ultrasensitive detection of FSH in immunoassays. The FSH antibody has been extensively characterized and shown to have high specificity and affinity for FSH. It can be used in different research areas within the Life Sciences field, such as studying the role of FSH in reproductive processes, investigating the effects of FSH on collagen and fibronectin production, or exploring its potential as a growth factor. Additionally, this monoclonal antibody may have neutralizing or cytotoxic effects on FSH-dependent processes. With its versatility and reliability, the FSH antibody is an essential tool for any researcher working with FSH-related studies.TTYH3 antibody
TTYH3 antibody was raised in rabbit using the middle region of TTYH3 as the immunogenPurity:Min. 95%Cortisol antibody
Cortisol antibody is a highly specific monoclonal antibody that targets cortisol, a steroid hormone involved in stress response and regulation of various physiological processes. This antibody can be used in research and diagnostic applications to detect and quantify cortisol levels in biological samples. It has been extensively validated for its high sensitivity and specificity, ensuring accurate and reliable results. The Cortisol antibody is produced using advanced techniques, including interferon activation and colloidal gold conjugation, resulting in a high-quality product with excellent performance characteristics. Whether you're studying the role of cortisol in stress-related disorders or developing diagnostic assays for hormonal imbalances, this Cortisol antibody is an essential tool for life sciences research.CMV pp65 antibody
CMV pp65 tegument protein antibody was raised in mouse using UL83 (pp65) of Cytomegalovirus as the immunogen.Rituximab - 10mg/ml solution
CAS:Rituximab is a glycosylated monoclonal antibody that binds to the CD20 cell surface protein which is widely expressed on B-cells. Through the binding of rituximabs Fc portion, the antibody-dependent cellular cytotoxicity pathway (ADCC) and the complement-dependent cytotoxicity (CDC) pathway are initiated, both leading to B-cell lysis (Chisari, 2021). In addition, direct apoptosis can be the result of the inhibition of various B-cell signalling pathways. Rituximab is used in targeted therapy for chronic lymphocytic leukaemia (CLL), non-Hodgkin lymphoma (NHL) and some non-cancer pathologies, such as, multiple sclerosis (Johnson, 2001).Formula:C6416H9874N1688O1987S44Purity:Min. 95 Area-%Color and Shape:Colorless Clear LiquidMolecular weight:143.86 kg/molGoat anti Human IgM
Goat anti Human IgM is a polyclonal antibody that specifically targets and neutralizes human IgM. It is commonly used in research and diagnostic applications to study the role of IgM in various biological processes. This antibody has been shown to inhibit the activity of polymers, chemokines, and other factors involved in immune responses. Additionally, it has been found to interact with cardiomyocytes and play a role in cardiac function. Goat anti Human IgM binds to specific amino-terminal regions of annexin A2, a protein involved in cell signaling and membrane dynamics. This antibody can be used in conjunction with streptavidin or other conjugates for detection purposes. It is highly effective at detecting activated forms of IgM and can be used to study immune responses in different tissues and fluids, including pleural fluid.Purity:Min. 95%EGF antibody
EGF antibody was raised in rabbit using highly pure recombinant human EGF as the immunogen.SV2A antibody
SV2A antibody was raised using the middle region of SV2A corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTPurity:Min. 95%Haptoglobin antibody
Haptoglobin antibody was raised in goat using highly purified bovine haptoglobin as the immunogen.Purity:Min. 95%Carbonic Anhydrase I antibody
Carbonic anhydrase I antibody was raised in sheep using human carbonic anhydrase II purified from erythrocytes as the immunogen.Purity:Min. 95%Morphine antibody
Morphine antibody was raised in rabbit using morphine-hemisuccinate as the immunogen.
Trypsin antibody
Trypsin antibody was raised in rabbit using human pancreatic trypsin as the immunogen.
