Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cytokeratin 8 antibody
The Cytokeratin 8 antibody is a powerful tool for researchers studying various biological processes. This monoclonal antibody specifically targets cytokeratin 8, a protein that plays a crucial role in cell structure and function. By binding to cytokeratin 8, this antibody can be used to detect and analyze the presence of this protein in different tissues and cell types.Purity:Min. 95%Cytokeratin 7 antibody
Cytokeratin 7 antibody was raised in mouse using cytoskeletal proteins from cultured HeLa cells as the immunogen.Chlamydia Abortus Elementary and Reticular Bodies Antigen
Please enquire for more information about Chlamydia Abortus Elementary and Reticular Bodies Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Parainfluenza type 2 antibody
Parainfluenza type 2 antibody was raised in mouse using parainfluenza virus, type 2 as the immunogen.Clostridum difficile toxin A antibody
Clostridum difficile toxin A antibody was raised in mouse using toxin/toxoid A of Clostridium difficile as the immunogen.Anti-Kat2 antibody - 2mg/mL
Kynurenine aminotransferase (Kat) enzymes convert Kynurenine (KYN) to kynurenic acid (KYNA) as part of the oxidative metabolism of tryptophan. KYNA is an endogenous antagonist of glutamate in the central nervous system. It is most active as an antagonist at receptors sensitive to N-methyl-D-aspartate (NMDA), which regulates neuronal excitability, plasticity, brain development, and behaviour. KYNA is also thought to play a causative role in hypo-glutamatergic conditions such as schizophrenia and a protective role in several neurodegenerative disorders, notably Huntington's disease. Of the 4 isoforms, Kat2 is the most active. Kat2 is a member of the Class-I pyridoxal-phosphate-dependent aminotransferase family. Kat2 is primarily located in brain tissue, believed to be in the mitochondria; accumulation of KYNA has been associated with schizophrenia. Selective inhibitors of Kat2 are being investigated as therapeutic targets for the management of schizophrenia and cognitive impairment.Lysozyme antibody
Lysozyme antibody was raised in rabbit using full length protein corresponding to amino acids 1-129 of Hen Egg White lysozyme as the immunogen.Purity:Min. 95%Myosin Light Chain 1 antibody
Myosin light chain 1 antibody was raised in mouse using myosin light chain-1 as the immunogen.LYVE1 antibody
LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
Purity:Min. 95%Chikungunya virus antibody
Chikungunya virus antibody is a highly effective solution for combating the Chikungunya virus. This antibody specifically targets and neutralizes the virus, preventing its replication and spread within the body. It works by binding to collagen, which is present on the surface of infected cells, effectively blocking the virus from entering healthy cells.KOR antibody
KOR antibody was raised in rabbit using residues 366-380 DPAYLRDIDGMNLPV of the human KOR-1 protein as the immunogen.
Purity:Min. 95%Influenza B antibody
Influenza B antibody is an essential product in the field of Life Sciences. This antibiotic is specifically designed to target and neutralize the Influenza B virus. It belongs to a class of Antibodies known as monoclonal antibodies, which are highly specific and effective in combating viral infections.Ubiquitin antibody
Ubiquitin antibody was raised in mouse using purified bovine erythrocyte ubiquitin as the immunogen.Purified Mouse anti-Progesterone Monoclonal
Please enquire for more information about Purified Mouse anti-Progesterone Monoclonal including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurified Rabbit anti-Human 17-OH Progesterone Antibody
Please enquire for more information about Purified Rabbit anti-Human 17-OH Progesterone Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this pageAF488 Anti-Phospho-GluR2 (pS880) antibod - 0.25mg/mL
The α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) is an ionotropic transmembrane receptor for glutamate found throughout the central nervous system (CNS). AMPARs are composed of four types of subunits: GluR1/GluA1, GluR2/GluA2, GluR3/GluA3, and GluA4 (GluRA-D2), which combine to form heterotetramers._x000D_ _x000D_ The GluR2 subunit interacts with several proteins and regulates the lysosomal targeting and degradation of AMPARs. Phosphorylation of AMPARs is often implicated in synaptic plasticity and the pathological signalling seen in several disease states. Phosphorylation of GluR2 on serine 880 is involved in changes of synaptic efficacy where it regulates GluR2 synaptic recycling, AMPA signalling strength and plasticity._x000D_ _x000D_ This antibody is conjugated to Alexa Fluor® 488. Alexa Fluor® 488 is a popular bright green fluorescent dye with high pH-stability.Purity:Min. 95%Zika virus NS1 antibody
Zika virus NS1 antibody is a mouse monoclonal antibody that recognizes the nonstructural protein 1 (NS1) of the Zika virus. NS1 is an immunodominant viral antigen associated with the humoral immune response to Zika virus. Antibodies targeting epitopes on the cell-surface form of NS1 have been shown to protect against Zika virus infection during pregnancy in mice. There is a high correlation between Zika virus NS1 antibodies and neutralizing antibodies in selected serum samples from normal healthy individuals. Mouse monoclonal antibodies against NS1 have the potential to be used as diagnostic tools for accurate diagnosis of Zika virus infection. Additionally, monoclonal antibodies against NS1 have the potential to suppress Zika virus pathogenicity without enhancement of the disease.Purity:>90% By Sds-PageTrastuzumab - 20mg/ml in PBS
CAS:Trastuzumab is a humanised immunoglobulin G1 monoclonal antibody against human epidermal growth factor receptor 2 (HER2), used in breast cancer treatments. Some potential extracellular and intracellular antitumor mechanisms of trastuzumab have been proposed, including activation of antibody-dependent cellular cytotoxicity, inhibition of extracellular domain cleavage, abrogation of intracellular signalling, reduction of angiogenesis and decreased DNA repair that result in tumour cell stasis and/or death. Its drug conjugate, trastuzumab deruxtecan (T-DXd), is used in the clinical therapy for pretreated HER2-mutant non-small cell lung cancer (NSCLC).Purity:Min. 95 Area-%Color and Shape:Clear LiquidAnti-mGluR1 antibody - 1mg/mL
Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that have been divided into three groups based on sequence, putative signal transduction mechanisms, and pharmacologic properties. mGluR1 is a group I receptor. Group I mGluRs are predominantly expressed in the postsynaptic somatodendritic regions, especially in brain areas highly responsive to psychostimulants. mGluR1 is a pivotal regulator of glutamatergic neurotransmission which is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions.
ATF2 antibody
ATF2 antibody was raised in Sheep using ATF-2; N-terminal fragment GST-fusion protein as the immunogen.Purity:Min. 95%Anti-PDE2A antibody R1G - 3mg/mL
PDEs are a family of phosphohydrolyases, used to catalyse hydrolysis of 3 €™ cyclic phosphate bonds in the second messengers adenosine and guanine 3 €™, 5 €™ cyclic monophosphates (cAMP and cGMP). Physiologically, PDE2A is a locus for communication between cAMP and cGMP signalling pathways, regulating this process through degradation of cAMP and cGMP. This is particularly noteworthy in cells where cAMP and cGMP regulate opposing cell functions.PDE2A is expressed both in the periphery and central nervous system, but is found in highest concentration in the brain; implying that PDE2A is necessary in regulation of interneuronal cAMP and cGMP involved in emotion, sensory perception and memory. Alteration in cyclic nucleotide signalling is shown cause depression, bipolar disorder and schizophrenia; hence PDE2A, a molecule used to break down cyclic nucleotides, has the potential to be a novel biomarker or therapeutic target for such psychiatric conditions.Mouse anti Human IgE (HRP)
IgE antibody was raised in Mouse using recombinant human IgE as the immunogen.Purity:Min. 95%PARK2 antibody
PARK2 antibody was raised in rabbit using residues 62-80 DQQSIVHIVQRPWRKGQEM of the human 52 kDa Parkin protein as the immunogen.
Purity:Min. 95%Glutathione Peroxidase antibody
Glutathione peroxidase antibody was raised in sheep using human glutathione peroxidase from Erythrocytes as the immunogen.Purity:Min. 95%Fibronectin antibody
Fibronectin antibody was raised in mouse using human plasma fibronectin as the immunogen.Purity:Min. 95%IL6 monoclonal antibody
The IL6 monoclonal antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to interleukin-6 (IL6), a protein involved in various biological processes such as inflammation and immune response. By blocking the interaction between IL6 and its receptors, this monoclonal antibody can modulate the activity of IL6, leading to potential therapeutic benefits.DAP12 antibody
The DAP12 antibody is a highly specialized antibody that is designed to target and bind to dinitrophenyl (DNP) antigens. It can be used in various applications, including research, diagnostics, and therapeutics. This antibody has been extensively studied and has shown excellent specificity and affinity for DNP antigens.Myoglobin antibody
Myoglobin antibody was raised in mouse using human Myoglobin as the immunogen.Purity:Min. 95%CD28 antibody (PE)
CD28 antibody (PE) was raised in hamster using CD28 costimulatory receptor as the immunogen.Purity:Min. 95%Molecular weight:0 g/molTroponin I antibody
The Troponin I antibody is a cytotoxic antibody that specifically targets the Troponin I protein. It is commonly used in Life Sciences research to study cardiac muscle function and diagnose heart diseases. This monoclonal antibody binds to Troponin I, a protein found in cardiac muscle cells, and can be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA). The Troponin I antibody has been extensively validated for its specificity and sensitivity, ensuring accurate and reliable results. With its high affinity for Troponin I, this antibody enables researchers to detect and quantify the presence of this protein in samples from human serum or tissue. Its activation potential makes it an ideal tool for studying the role of Troponin I in various physiological processes, including muscle contraction and regulation. The Troponin I antibody is a valuable asset for any researcher looking to gain insights into cardiac function and related disorders.Purity:Min. 95%Xentuzumab
CAS:Humanized IgG1 insulin-like growth factor (IGF) monoclonal antibody targeting the IGF ligands 1 (IGF-1) and 2 (IGF-2)CA 125 antibody
The CA 125 antibody is a monoclonal antibody that specifically targets the CA 125 antigen. This antigen is a protein that is found on the surface of certain cells, including ovarian cancer cells. The CA 125 antibody has cytotoxic properties, meaning it can selectively kill cells that express the CA 125 antigen.Keratin K5 antibody
Keratin K5 antibody was raised in Mouse using a purified recombinant fragment of Keratin K5 expressed in E. coli as the immunogen.Sulesomab
CAS:Human mouse monoclonal antibody targeting NCA-90 (granulocyte cell antigen), imaging of infections and inflammation in osteomyelitisNeisseria gonorrhoeae antibody
Neisseria gonorrhoeae antibody is a monoclonal antibody that targets the EGF-like protein expressed by Neisseria gonorrhoeae, the bacteria responsible for gonorrhea. This antibody specifically binds to the EGF-like protein, preventing its interaction with host cells and neutralizing its activity. It has also been shown to inhibit the growth of other bacteria, such as Mycoplasma genitalium. Additionally, this antibody has cytotoxic effects on infected cells, leading to their destruction. The use of Neisseria gonorrhoeae antibody in clinical settings can aid in the diagnosis and treatment of gonorrhea and related infections.
Citatuzumab Bogatox
CAS:Antibody-drug conjugate (ADC) Cituximab bogatox is a therapeutic agent comprising a Fab fragment of a humanized antibody directed against EpCAM and a modified cytotoxin bouganin.Goat anti Cat IgG (H + L) (HRP)
Goat anti-feline IgG (H + L) (HRP) was raised in goat using feline IgG (H & L) as the immunogen.ApoE antibody
The ApoE antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in the clearance of amyloid plaques associated with Alzheimer's disease. This antibody has been extensively studied and validated in various assays, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.Anti-Jak2 antibody R2G - 0.5mg/mL
Janus kinase-2 (JAK2) is a non-receptor tyrosine kinase implicated in signalling via members of the type II cytokine receptor family (such as interferon receptors), the GM-CSF receptor family (IL-3R, IL-5R and GM-CSF-R), the gp130 receptor family (e.g., IL-6R), and the single chain receptors (e.g. Epo-R, Tpo-R, GH-R, PRL-R). The JAK/signal transducer and activator of transcription (STAT) pathway is a key cellular pathway which is involved in immunity, cell division, cell death and tumour formation. The JAK/STAT pathway is activated by leptin and the leptin receptor and results in phosphorylation of STAT3 and its translocation to the nucleus where it activates the transcription of various target genes.Mutations and gene fusions involving JAK2 have been implicated in polycythemia vera, essential thrombocythemia, and myelofibrosis as well as other myeloproliferative disorders and leukaemia.Birtamimab
CAS:Investigational humanized monoclonal antibody; neutralizes light chain aggregates and remove organ-deposited amyloidAnti-FADD antibody J70 - 0.5mg/mL
Anti-FADD antibody corresponding to a region within the human FADD protein sequenceAF488 Anti-NR1 4b antibody - 0.64mg/mL
N-methyl-D-aspartate receptors (NMDARs) are ligand-gated ionotropic glutamate receptors that mediate excitatory synaptic transmission and play important roles in many aspects of nervous system function including: synaptic plasticity; learning and memory; neuronal development and circuit formation. NMDARs have been implicated in various neuronal disorders. NMDARs are heteromers consisting of an obligate NR1 subunit and most commonly one or two kinds of NR2 subunits or occasionally NR3 subunits. The NR1 subunit is alternatively spliced yielding eight possible isoforms characterised by the inclusion or deletion of exons 5, 21 and 22. The splice variants are developmentally and spatially regulated and modulate the biophysical properties of NMDARs and alter the trafficking behaviour of NR1. NR1-4b Splice variants includes exons 5, 21, and 22 and is expressed in the dorsal horn of the spinal cord. The involvement of NMDAR in the central nervous system (CNS) has become a focus area for neurodegenerative diseases such as Alzheimer's disease, epilepsy and ischemic neuronal cell death. This antibody is conjugated to AF488. AF488 is a popular bright green fluorescent dye with high pH-stability.
TSNAX antibody
TSNAX antibody was raised in mouse using recombinant Human Translin-Associated Factor X
GCSF antibody
GCSF antibody was raised in Mouse using recombinant human G-CSF as the immunogen.Purity:Min. 95%Adenovirus antibody
Adenovirus antibody was raised in mouse using hexon group antigen of many ADV serotypes as the immunogen.Mapatumumab
CAS:A fully human IgG1 agonistic monoclonal antibody that targets tumor necrosis factor-related apoptosis-inducing ligand receptor 1 (TRAIL-R1).Goat anti Mouse IgG (H + L)
Goat anti Mouse IgG was raised in goat using affinity pure mouse IgG (H + L) as the immunogen.
Purity:Min. 95%Zanidatamab
CAS:IgG1 bi-specific monoclonal antibody targeting two epitopes of the human tumor-associated antigen (TAA) epidermal growth factor receptor 2 (HER2), ECD2 and ECD4TrkB antibody
TrkB antibody was raised in rabbit using the entire extracellular domain of rat TrkB receptor as the immunogen.Purity:Min. 95%HSA antibody
The HSA antibody is a highly specialized monoclonal antibody that targets specific proteins and molecules in the human body. It has been extensively studied for its ability to neutralize influenza hemagglutinin, adeno-associated virus, and other viral antigens. Additionally, this antibody has shown promising results in targeting anti-mesothelin, activated fibrinogen, alpha-fetoprotein, and chemokine receptors. One of the key features of the HSA antibody is its antiviral activity. It has been found to effectively inhibit viral replication and prevent viral entry into host cells. This makes it a valuable tool in the development of antiviral therapies and vaccines. Moreover, the HSA antibody has been used in various research applications involving mesenchymal stem cells. It can be utilized to identify and isolate these cells from human serum or other biological samples. The antibody's specificity ensures accurate detection and characterization of mesenchymal stem cells for further study or therapeutic purposes. AdditionallyGoat anti Human IgM
Goat anti-human IgM was raised in goat using human IgM mu chain as the immunogen.
Purity:Min. 95%Anti-POLDIP3 antibody - 2mg/mL
POLDIP3 is preferentially associated with CBC-bound spliced mRNA-protein complexes during the initial round of mRNA translation. POLDIP3 is deposited at the exon junction during pre-mRNA splicing. It becomes part of the exon junction complex (EJC), which then facilitates the recruitment of S6K1 to the spliced RNA to boost the translation efficiency of the spliced mRNA. In addition, POLDIP3 is involved in nuclear mRNA export mediated by association with the TREX complex.Neu antibody
Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.Purity:Min. 95%
