Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Hemoglobin epsilon antibody
Hemoglobin epsilon antibody was raised in mouse using hemoglobin Gower-I (a2e2) isolated from culture fluids of the cell line K562 as the immunogen.hCG alpha antibody
The hCG alpha antibody is a monoclonal antibody that specifically targets the hormone hCG (human chorionic gonadotropin). This antibody recognizes a specific amino acid sequence in the hCG protein polypeptide and can be used in various applications in the field of Life Sciences. The hCG alpha antibody is produced using transgenic technology, resulting in a high-quality recombinant protein with excellent specificity and affinity.CRP antibody
The CRP antibody is a monoclonal antibody specifically designed for the detection of C-reactive protein (CRP) in human serum. It is commonly used in clinical laboratories and research settings for various applications. The antibody is immobilized on a carbon electrode or microsphere composition, allowing for easy and accurate detection of CRP levels.Purity:Two Bands @ ~29 Kd And ~55 Kd By Sds Page (Reduced)Cryptosporidium parvum antibody
Cryptosporidium parvum antibody was raised in mouse using Cryptosporidium parvum as the immunogen.Zika virus NS1 antibody
The Zika virus NS1 antibody is a highly specific monoclonal antibody that targets the NS1 protein of the Zika virus. This antibody has been extensively studied and proven to be effective in detecting and neutralizing the Zika virus. It binds to the NS1 protein, preventing its interaction with host cells and inhibiting viral replication.
VZV (nucleocapsid) antibody
VZV (nucleocapsid) antibody was raised in mouse using varicella zoster virus HZ strain as the immunogen.Hemoglobin antibody
The Hemoglobin antibody is a protein that specifically targets and binds to hemoglobin. It has been shown to have neutralizing effects on the activity of hemoglobin, preventing its interaction with other molecules and interfering with its normal function. This antibody is widely used in Life Sciences research, particularly in studies involving hemoglobin-related disorders and diseases.FABP antibody
The FABP antibody is a monoclonal antibody that specifically targets a human protein. It belongs to the class of antibodies known as TGF-beta, which are involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.Purity:>92% By Gel Electrophoresis And Gel ScanningSV40 T Antigen antibody
SV40 T antigen antibody was raised in mouse using the N-terminal domain of SV40 large and small T-antigen as the immunogen.
Parvovirus antibody
Parvovirus antibody was raised in mouse using canine parvovirus as the immunogen.ELL2 antibody
ELL2 antibody was raised in mouse using recombinant Human Elongation Factor, Rna Polymerase Ii, 2alpha Tubulin antibody
Alpha tubulin antibody was raised in mouse using alpha-tubulin isolated from chick brain microtubules as the immunogen.VEGF antibody
VEGF antibody was raised in mouse using highly pure recombinant human VEGF165 as the immunogen.Dengue virus antibody
Dengue virus antibody is a monoclonal antibody that specifically targets the glycoprotein antigen of the dengue virus. This antibody is produced using advanced techniques in the field of Life Sciences. It has been shown to effectively bind to and neutralize the dengue virus, preventing its replication and spread within the body. The Dengue virus antibody has high specificity and affinity for the viral glycoproteins, making it a valuable tool for research and diagnostic purposes. It can be used in various applications, including immunohistochemistry, ELISA assays, and Western blotting. The antibody is stable in both methanol and butanol solutions, allowing for flexible experimental conditions. With its ability to recognize different serotypes of the dengue virus, this monoclonal antibody provides a reliable means of detecting and studying this infectious pathogen.TCR gamma delta antibody
The TCR gamma delta antibody is a highly specialized globulin that has been developed for use in various research applications. It is a monoclonal antibody that specifically targets and binds to the T-cell receptor gamma delta, an important component of the immune system. This antibody can be used in studies involving human serum, as well as in the detection and analysis of autoantibodies and insulin antibodies. Additionally, it has been shown to have neutralizing activity against certain growth factors such as epidermal growth factor. The TCR gamma delta antibody is widely used in life sciences research and is available in a highly purified form, free from any unwanted excipients. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related processes.
CEA antibody
The CEA antibody is a monoclonal antibody that acts as an inhibitor of nuclear β-catenin. It has neutralizing properties and inhibits the activity of inhibitory factors in the body. This antibody specifically targets basic proteins and vitamin D-binding proteins, blocking their function. Additionally, it interacts with IFN-gamma and chemokines, modulating their effects on the immune system. The CEA antibody is a highly effective tool for research purposes and can be used in various applications such as immunohistochemistry, flow cytometry, and western blotting. With its high specificity and affinity, this antibody offers reliable results for experiments involving alpha-fetoprotein and other related targets.ApoA-I antibody
ApoA-I antibody was raised in mouse using human apolipoprotein A-1 (HDL) as the immunogen.HBsAg antibody
The HBsAg antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the hepatitis B surface antigen (HBsAg). This antibody plays a crucial role in various applications, including hybridization, protein analysis, and research involving cell signaling pathways.E. coli antibody (FITC)
E. coli antibody (FITC) was raised in rabbit using mixtures of all antigenic serotypes as the immunogen.Parainfluenza type 1 antibody
Parainfluenza type 1 antibody was raised in mouse using Parainfluenza 1 as the immunogen.HTATIP antibody
HTATIP antibody was raised in mouse using recombinant Human Hiv-1 Tat Interacting Protein, 60Kda (Htatip)gp64 protein antibody
The gp64 protein antibody is a monoclonal antibody that specifically targets and binds to the glial fibrillary acidic protein (GFAP). GFAP is an important marker for astrocytes, a type of glial cell in the central nervous system. This antibody is widely used in Life Sciences research to study astrocyte activation and function. The gp64 protein antibody has been shown to have neutralizing effects on GFAP, which can help researchers investigate the role of astrocytes in various neurological disorders and diseases. Additionally, this antibody has been used to detect GFAP expression in mesothelial cells and has shown reactivity towards peptide antigens. In addition to its research applications, the gp64 protein antibody is also used in diagnostic assays to detect GFAP levels in human serum samples. The detection of elevated GFAP levels can provide valuable insights into certain neurological conditions, such as traumatic brain injury or neurodegenerative diseases. Overall, the gp64 protein antibody is a valuable tool for researchersVibrio cholerae O1 Ogawa & Inaba antibody
The Vibrio cholerae O1 Ogawa & Inaba antibody is a monoclonal antibody that has been activated to target and neutralize the bacteria responsible for causing cholera. This antibody is an effective tool in combating the infection and can be used in combination with antibiotics for optimal results. It specifically targets the atypical hemolytic strains of Vibrio cholerae, including multidrug-resistant strains. The antibody works by binding to specific proteins on the surface of the bacteria, inhibiting their ability to cause harm. Additionally, it has shown potential in treating autoimmune disorders associated with actin antibodies. The Vibrio cholerae O1 Ogawa & Inaba antibody is a valuable asset in Life Sciences research and holds promise as a therapeutic agent against cholera and related infections.RBP4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The efficacy of this drug has been demonstrated through extensive research using advanced techniques like patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.CD163 antibody
The CD163 antibody is a monoclonal antibody that has neutralizing properties. It binds to the CD163 glycoprotein, which is highly reactive in human serum. This antibody can be used in various life science applications and research studies. It can be used as a tool for detecting and quantifying CD163 in samples, as well as for studying its role in different biological processes. The CD163 antibody can also be used in diagnostic assays or therapeutic applications due to its ability to target specific cells or molecules. Additionally, this antibody has been shown to exhibit catalase activity, making it suitable for use in experiments involving oxidative stress or antioxidant defense mechanisms. With its wide range of potential applications, the CD163 antibody is a valuable tool for researchers and scientists working in various fields of study.Anti-RAF1 antibody - 0.5mg/mL
Raf1 forms part of the histone H3K9 methyltransferase complex CLRC, along with Clr4, Raf2, Cul4, and Rik1 and is required for heterochromatin formation. CLRC mediates H3K9 methylation, siRNA production and also displays E3-ubiquitin ligase activity in vitro.GTF2H4 antibody
GTF2H4 antibody was raised in mouse using recombinant Human General Transcription Factor Iih, Polypeptide 4, 52KdaCKMB antibody
The CKMB antibody is a highly specialized product used in the field of Life Sciences. It belongs to the class of Antibodies and specifically targets CKMB dimers. This Monoclonal Antibody is designed to immobilize and neutralize activated CKMB, which is crucial for accurate diagnostic testing.USP18 antibody
USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHGliadin Antibody
Gliadin Antibody is an acidic antibody that targets the vascular endothelial growth factor (VEGF), a key regulator of blood vessel formation. It is commonly used in Life Sciences research to study angiogenesis and the role of VEGF in various biological processes. Gliadin Antibody is a monoclonal antibody that specifically binds to VEGF, inhibiting its interaction with its receptor and preventing downstream signaling pathways involved in blood vessel growth. This antibody has also been used in assays to detect the presence of VEGF in biological samples and to study its interactions with other molecules such as calmodulin and erythropoietin. Additionally, Gliadin Antibody has shown potential therapeutic applications in diseases characterized by abnormal angiogenesis, such as cancer and certain cardiovascular disorders.Rabbit anti Chicken IgY (H + L) (FITC)
Rabbit anti-chicken IgY (H + L) (FITC) was raised in rabbit using chicken IgG (H & L) as the immunogen.NDUFC1 antibody
NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLGoat anti Bovine IgG (H + L) (HRP)
Goat anti-bovine IgG (H + L) (HRP) was raised in goat using bovine IgG (H & L) as the immunogen.EV71 antibody
The EV71 antibody is a highly specialized monoclonal antibody that targets annexin A2, elastase, and pancreatic elastase. It is used in the field of Life Sciences to study autoantibodies and their role in various diseases. This antibody has been extensively studied for its ability to bind to insulin and fibronectin, two key proteins involved in cell signaling and tissue development. Additionally, the EV71 antibody has shown cytotoxic effects against cancer cells and has been used in research related to TGF-beta signaling pathways. Its high specificity and affinity make it an invaluable tool for researchers studying lectins, collagen, and other biomolecules.Anti-Pde2a antibody R2G - 2mg/mL
PDEs are a family of phosphohydrolyases, used to catalyse hydrolysis of 3 €™ cyclic phosphate bonds in the second messengers adenosine and guanine 3 €™, 5 €™ cyclic monophosphates (cAMP and cGMP). Physiologically, Pde2a is a locus for communication between cAMP and cGMP signalling pathways, regulating this process through degradation of cAMP and cGMP. This is particularly noteworthy in cells where cAMP and cGMP regulate opposing cell functions.Pde2a is expressed both in the periphery and central nervous system, but is found in highest concentration in the brain; implying that Pde2a is necessary in regulation of interneuronal cAMP and cGMP involved in emotion, sensory perception and memory. Alteration in cyclic nucleotide signalling is shown cause depression, bipolar disorder and schizophrenia; hence Pde2a, a molecule used to break down cyclic nucleotides, has the potential to be a novel biomarker or therapeutic target for such psychiatric conditions.Cytokeratin 8 antibody (biotin)
Cytokeratin 8 antibody (biotin) was raised in mouse using cytoskeletal proteins from cultured HeLa Cells as the immunogen.
Legionella pneumophila (Serogroup 1) antibody
Legionella pneumophila (serogroup 1) antibody was raised in mouse using Legionella pneumophila antigenic subgroup knoxville 1 as the immunogen.Zika virus NS1 antibody
Zika virus NS1 antibody is a mouse monoclonal antibody that recognizes the nonstructural protein 1 (NS1) of the Zika virus. NS1 is an immunodominant viral antigen associated with the humoral immune response to Zika virus. Antibodies targeting epitopes on the cell-surface form of NS1 have been shown to protect against Zika virus infection during pregnancy in mice. There is a high correlation between Zika virus NS1 antibodies and neutralizing antibodies in selected serum samples from normal healthy individuals. Mouse monoclonal antibodies against NS1 have the potential to be used as diagnostic tools for accurate diagnosis of Zika virus infection. Additionally, monoclonal antibodies against NS1 have the potential to suppress Zika virus pathogenicity without enhancement of the disease.Purity:>90% By Sds-PageMyoglobin antibody
Myoglobin antibody was raised in mouse using human heart myoglobin as the immunogen.hCG beta antibody
hCG beta antibody was raised in mouse using human chorionic gonadotropin beta as the immunogen.Heartworm antibody
Heartworm antibody was raised in rabbit using dirofilaria immitis as the immunogen.HPV16 E7 antibody
The HPV16 E7 antibody is a monoclonal antibody that specifically targets the human papillomavirus 16 (HPV16) E7 protein. This protein plays a crucial role in the development and progression of HPV-related cancers, making it an important target for therapeutic interventions.Aurora™ Fluor 488 Anti-2SC antibody - 0.7mg/mL
Succination is a stable post-translational modification of cysteine residues, which modifies protein function or turnover in response to a changing intracellular redox environment. Succination occurs when the Krebs cycle intermediate, fumarate, reacts with cysteine yielding S-(2-succino)cysteine (2SC). A wide range of proteins are subject to succination, including enzymes, adipokines, cytoskeletal proteins and ER chaperones and succination has been shown to have roles in regulatory biology.An increase in succination of adipocyte proteins is seen in diabetes mellitus and results from nutrient excess derived mitochondrial stress. 2SC therefore serves as a biomarker of mitochondrial stress or dysfunction in chronic diseases, such as obesity, diabetes, and cancer.This Antibody is conjugated to a popular bright green flourescent dye: Aurora TM Fluor 488.Color and Shape:PowderDNMT3B antibody
DNMT3B antibody was raised in mouse using recombinant Human Dna (Cytosine-5-)-Methyltransferase 3 Beta (Dnmt3B)Anti-Phospho-CDK2 (pY15) antibody - 1mg/mL
Cyclin-dependent kinases (CDKs) are regulated by positive and negative phosphorylation. T14/Y15 phosphorylation by the WEE1 and MYT1 kinases inhibits CDKs by preventing ATP binding, and these conserved phosphorylations are highly regulated during the cell cycle and by signalling pathways. WEE1 and MYT1 are opposed by cell division cycle 25 (CDC25) phosphatases, which, in mammals, comprise three related enzymes that dephosphorylate T14/Y15 to promote CDK activity.ApoA-I antibody
ApoA-I antibody was raised in mouse using human Apo A-I as the immunogen.Purity:>95% By Sds-PageHemoglobin antibody
The Hemoglobin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to hemoglobin, a vital protein responsible for carrying oxygen in the blood. This antibody has shown reactivity towards various forms of hemoglobin, including those found in human serum.Purity:>95%Calcitonin antibody
Calcitonin antibody was raised in mouse using calcitonin conjugated with carrier protein as the immunogen.Calcitonin antibody
Calcitonin antibody is a growth factor that plays a crucial role in regulating calcium and phosphate levels in the body. It is an antibody that specifically targets calcitonin, a hormone involved in bone metabolism. This monoclonal antibody is highly specific and has been developed for use in life sciences research. It can be used to study the function of calcitonin and its effects on various biological processes.Metapneumovirus antibody
Metapneumovirus antibody was raised in mouse using matrix protein of human metapneumovirus as the immunogen.Lactoferrin antibody
The Lactoferrin antibody is a highly specialized protein that belongs to the group of antibodies used in Life Sciences. It plays a crucial role in various biological processes, including collagen synthesis and immune response. This Monoclonal Antibody specifically targets lactoferrin, a disulfide-bonded protein found in human serum. It has been extensively studied for its potential therapeutic applications, including its ability to neutralize tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and inhibit the growth of cancer cells. Additionally, this antibody has been used as a diagnostic tool to detect autoantibodies and alpha-fetoprotein in clinical settings. With its high specificity and affinity, the Lactoferrin antibody offers promising opportunities for research and medical applications.Luteinizing Hormone antibody
Luteinizing hormone antibody was raised in mouse using human pituitary luteinizing hormone as the immunogen.CA 15-3 antibody
CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.Clostridum difficile toxin A antibody
Clostridum difficile toxin A antibody was raised in mouse using toxin/toxoid A of Clostridium difficile as the immunogen.Troponin I antibody
Troponin I antibody is a specialized antibody used in Life Sciences research. It is designed to target and bind to troponin I, a protein found in cardiac muscle tissue. This antibody specifically recognizes troponin I dimers and can be used for various applications such as immunohistochemistry, western blotting, and ELISA assays. Troponin I antibody plays a crucial role in the detection and quantification of troponin I levels, which are important indicators of heart damage or myocardial infarction. It has been extensively used in studies related to cardiovascular diseases and has shown excellent specificity and sensitivity. This monoclonal antibody is highly effective in neutralizing the effects of interferon-gamma (IFN-gamma) and superoxide production induced by IFN-gamma. With its high affinity for troponin I, this antibody is an invaluable tool for researchers studying cardiac function and disease mechanisms.Plakophilin 3 antibody
Plakophilin 3 antibody was raised in mouse using recombinant protein (E.Coli) of human plakophilin 3 as the immunogen.
Thyroxine antibody
Thyroxine antibody is a monoclonal antibody that specifically targets and binds to thyroxine, a hormone produced by the thyroid gland. This antibody has been extensively studied for its role in regulating the levels of thyroxine in the body. It has been shown to have neutralizing effects on the activity of thyroxine, which can help in the treatment of conditions such as hyperthyroidism or Graves' disease. Additionally, this antibody has shown potential as a therapeutic agent in cancer treatment, as it can inhibit the growth factor signaling pathways associated with tumor development. The high specificity and affinity of this monoclonal antibody make it a valuable tool for research and diagnostic purposes in the field of life sciences.Salmonella antibody
Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.Anti-OOEP antibody - 1mg/mL
Factor located in oocytes permitting embryonic development (FLOPED)/OOEP, along with, MATER, TLE6 and Filia, forms the subcortical maternal complex (SCMC). The SCMC assembles during oocyte growth and is essential for zygotes to progress beyond the first embryonic cell divisions.Color and Shape:Clear LiquidNMDAR1 antibody
The NMDAR1 antibody is a monoclonal antibody that specifically targets the N-methyl-D-aspartate receptor 1 (NMDAR1). This receptor plays a crucial role in synaptic plasticity and learning. The NMDAR1 antibody has been extensively studied and shown to have neutralizing properties against NMDAR1, preventing its activation by glutamate. This antibody has also been found to be effective in inhibiting the growth of Cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. Additionally, the NMDAR1 antibody has potential therapeutic applications in the treatment of conditions such as insulin resistance, as it can modulate insulin signaling pathways. It is also being investigated for its potential role in regulating natriuretic peptide levels and as a growth factor for certain cell types. With its ability to target specific receptors and modulate various biological processes, the NMDAR1 antibody holds great promise in both research and therapeutic applications.Cortisol antibody
The Cortisol antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets cortisol, a hormone involved in stress response and regulation of various physiological processes. This antibody enables the detection and measurement of cortisol concentration in biological samples.CREST antibody
The CREST antibody is a monoclonal antibody that specifically targets transthyretin, a protein involved in various biological processes. This antibody is widely used in Life Sciences research and diagnostics. It can be used in a variety of applications, including immunohistochemistry, western blotting, and ELISA assays. The CREST antibody has been shown to effectively bind to transthyretin in human hepatocytes and other cell types. It can also be used as an electrode for electrochemical analysis or as a tool for antibody-mediated cytotoxicity studies. With its high specificity and binding affinity, the CREST antibody is an essential tool for researchers studying transthyretin-related diseases and exploring therapeutic options.
PKM2 antibody
The PKM2 antibody is a highly specialized monoclonal antibody that has a strong affinity for the pyruvate kinase M2 isoform. This antibody binds specifically to the receptor sites of PKM2, inhibiting its activity and preventing the conversion of phosphoenolpyruvate (PEP) to pyruvate. As a result, glycolysis is disrupted, leading to decreased ATP production and altered metabolic pathways.HSV1 + HSV2 ICP27 antibody
HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.HBsAg antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and effectiveness against tuberculosis infection, it stands as one of the most active compounds in treating this condition. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its metabolism involves various transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.HbA1c antibody
The HbA1c antibody is a mouse monoclonal antibody that specifically binds to the HbA1c protein. This antibody is commonly used in Life Sciences research to study the role of HbA1c in various biological processes. It can be used to detect and quantify HbA1c levels in blood samples, making it a valuable tool for monitoring diabetes and glycemic control. It does not cross react with HBA1O.Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.Anti-B-Raf antibody - 0.1mg/mL
B-Raf (BRAF) is a raf-family serine/threonine kinase and proto-oncogene involved in directing cell growth. The Raf kinases are subject to a complex activation process that integrates various protein-protein and protein-lipid interactions and positive as well as negative phosphorylation events. The Ras/Raf/mitogen-activated/extracellular-regulated kinase (MEK)/extracellular signal regulated kinase (ERK) pathway plays a pivotal role in controlling proliferation, survival and differentiation of metazoan cells.Methadone antibody
Methadone antibody was raised in mouse using methadone-BSA as the immunogen.Purity:>95% By Sds-PagePOLQ antibody
POLQ antibody was raised using a synthetic peptide. The 14 aa immunogen is in this broader region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL.FSH antibody
The FSH antibody is a monoclonal antibody that has the ability to specifically bind to follicle-stimulating hormone (FSH). This antibody can be used for various applications, including lysis of FSH-producing cells and ultrasensitive detection of FSH in immunoassays. The FSH antibody has been extensively characterized and shown to have high specificity and affinity for FSH. It can be used in different research areas within the Life Sciences field, such as studying the role of FSH in reproductive processes, investigating the effects of FSH on collagen and fibronectin production, or exploring its potential as a growth factor. Additionally, this monoclonal antibody may have neutralizing or cytotoxic effects on FSH-dependent processes. With its versatility and reliability, the FSH antibody is an essential tool for any researcher working with FSH-related studies.Anti-Jak2 antibody R2G - 1mg/mL
Janus kinase-2 (JAK2) is a non-receptor tyrosine kinase implicated in signalling via members of the type II cytokine receptor family (such as interferon receptors), the GM-CSF receptor family (IL-3R, IL-5R and GM-CSF-R), the gp130 receptor family (e.g., IL-6R), and the single chain receptors (e.g. Epo-R, Tpo-R, GH-R, PRL-R). The JAK/signal transducer and activator of transcription (STAT) pathway is a key cellular pathway which is involved in immunity, cell division, cell death and tumour formation. The JAK/STAT pathway is activated by leptin and the leptin receptor and results in phosphorylation of STAT3 and its translocation to the nucleus where it activates the transcription of various target genes.Mutations and gene fusions involving JAK2 have been implicated in polycythemia vera, essential thrombocythemia, and myelofibrosis as well as other myeloproliferative disorders and leukaemia.Actin antibody
Actin antibody was raised in mouse using synthetic N- terminus decapeptide of alpha-smooth-muscle isoform of actin as the immunogen.CRP antibody
The CRP antibody is a highly specialized drug antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to neutralize and immobilize agonist proteins, thereby inhibiting their activity. This antibody is buffered and activated to ensure optimal performance and efficacy.AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. With its specific binding ability to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.Cortisol antibody
Cortisol antibody is a highly specific monoclonal antibody that targets cortisol, a steroid hormone involved in stress response and regulation of various physiological processes. This antibody can be used in research and diagnostic applications to detect and quantify cortisol levels in biological samples. It has been extensively validated for its high sensitivity and specificity, ensuring accurate and reliable results. The Cortisol antibody is produced using advanced techniques, including interferon activation and colloidal gold conjugation, resulting in a high-quality product with excellent performance characteristics. Whether you're studying the role of cortisol in stress-related disorders or developing diagnostic assays for hormonal imbalances, this Cortisol antibody is an essential tool for life sciences research.
