Primary Antibodies

<p>ADCY1 antibody was raised in Rabbit using Human ADCY1 as the immunogen</p>

<p>PCNA antibody (biotin) was raised in mouse using recombinant rat proliferating cell nuclear antigen protein as the immunogen.</p>

Mouse monoclonal Malaria HRP2 antibody

PDGFr antibody was raised in sheep using PDGFr-rDNA expression of the b domain (GST fusion) as the immunogen.

<p>Chlamydia Abortus Elementary and Reticular Bodies Antigen is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Abortus Elementary and Reticular Bodies Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

The HSA antibody is a highly specialized monoclonal antibody that targets specific proteins and molecules in the human body. It has been extensively studied for its ability to neutralize influenza hemagglutinin, adeno-associated virus, and other viral antigens. Additionally, this antibody has shown promising results in targeting anti-mesothelin, activated fibrinogen, alpha-fetoprotein, and chemokine receptors. One of the key features of the HSA antibody is its antiviral activity. It has been found to effectively inhibit viral replication and prevent viral entry into host cells. This makes it a valuable tool in the development of antiviral therapies and vaccines. Moreover, the HSA antibody has been used in various research applications involving mesenchymal stem cells. It can be utilized to identify and isolate these cells from human serum or other biological samples. The antibody's specificity ensures accurate detection and characterization of mesenchymal stem cells for further study or therapeutic purposes. Additionally

<p>The PSA antibody is a growth factor that belongs to the class of monoclonal antibodies. It has the ability to specifically bind to prostate-specific antigen (PSA) and inhibit its activity. This antibody can be used for various applications in the field of Life Sciences, including ultrasensitive detection of PSA levels in patient samples. The PSA antibody has been shown to induce lysis of PSA-expressing cells and neutralize its biological effects. It also has the ability to bind to collagen and fibronectin, which are important components of the extracellular matrix. In addition, this monoclonal antibody can be activated to exert cytotoxic effects on target cells. Its efficacy can be measured using techniques such as electrochemical impedance spectroscopy.</p>

CD79b antibody was raised in mouse using human CD79b as the immunogen.

<p>Donkey anti-rabbit IgG (H + L) (Fab'2) (HRP) was raised in donkey using rabbit IgG (H&amp;L) as the immunogen.</p>

<p>Monoclonal antibody binds to PD-1 and blocks the interaction with PDL-1;cancer immunotherapy</p>

Raf1 forms part of the histone H3K9 methyltransferase complex CLRC, along with Clr4, Raf2, Cul4, and Rik1 and is required for heterochromatin formation. CLRC mediates H3K9 methylation, siRNA production and also displays E3-ubiquitin ligase activity in vitro.

<p>E3 Ubiquitin ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme as a thioester and then directly transfer the ubiquitin to targeted substrates. DZIP3 is located in the cytoplasm and can bind RNA specifically. DZIP3 enables several functions, including phosphatase binding activity; polyubiquitin modification-dependent protein binding activity; and ubiquitin-protein transferase activity. In addition, DZIP3 is involved in protein polyubiquitination._x000D_<br>_x000D_<br>The condition of azoospermia is associated with the deletion of DZIP3. High expression of DZIP3 is a biomarker for a poor outcome of several cancers, including gastric and breast cancer. DZIP3 is a crucial driver of cancer cell growth, migration, and invasion due to interacting with cyclin D1 during G1. In breast cancer, DZIP3 is a coactivator of oestrogen receptor α target gene expression and enhances their expression in breast cancer cells.</p>

<p>RSV antibody was raised in mouse using fusion protein of RSV, types A and B as the immunogen.</p>

Please enquire for more information about Dengue Type 4 antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>The PKC gamma antibody is a polyclonal antibody that is used for the immobilization and detection of protein kinase C (PKC) gamma. It is cytotoxic and can neutralize the activity of PKC gamma in human serum. This antibody has ultrasensitive detection capabilities, allowing for accurate measurement of PKC gamma levels in various biological samples. The PKC gamma antibody can be used in immunoassays and other life science applications to study the role of PKC gamma in cellular signaling pathways, including endothelial growth and collagen synthesis. With its high specificity and affinity, this monoclonal antibody is a valuable tool for researchers studying PKC gamma and its associated functions.</p>

P12 is a cleavage product from the murine leukaemia virus (MLV) Gag protein and is essential for various steps in viral replication and during both early and late stages of murine leukaemia virus (MLV) infection.

<p>Rabbit polyclonal TUBA8 antibody</p>

Plasmodium falciparum antibody was raised in mouse using histadine rich protein II from Plasmodium falciparum as the immunogen.

<p>Chromogranin A antibody was raised in rabbit using recombinant protein encoding human chromogranin A as the immunogen.</p>

<p>CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL</p>

<p>GPRC5B</p>

RBC antibody is a monoclonal antibody used for immunohistochemical detection. It is specifically designed to detect and bind to red blood cells in human serum. This antibody has been shown to have toxic effects on RBCs, leading to cell damage and lipid peroxidation. In addition to monoclonal antibodies, polyclonal antibodies can also be used for the detection of RBCs. These antibodies are produced by different B-cell clones and can recognize multiple epitopes on the target antigen. The use of polyclonal antibodies allows for increased sensitivity in detecting RBCs. Furthermore, the presence of autoantibodies against RBCs has been observed in certain conditions such as intravascular hemolysis or autoimmune disorders. These autoantibodies can lead to the destruction of RBCs and contribute to the development of anemia. Overall, the detection and characterization of RBC antibodies play a crucial role in understanding various physiological and pathological processes involving red blood cells.

<p>EPO antibody was raised in mouse using human EPO as the immunogen.</p>

<p>Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.</p>

<p>Goat anti-Human IgG Antiserum</p>

CMV antibody was raised in goat using purified virions of strain AD169 as the immunogen.

Inactivates IL-17A; psoriasis therapy

<p>Recognizes the amino acid region 2190-2300</p>

<p>Tocilizumab is an immunosuppressive agent used in the treatment of rheumatoid arthritis. Chemically, tocilizumab is a monoclonal antibody that interferes with the binding of interleukin-6 (IL-6) to its receptor (IL-6R). Tocilizumab has been positively applied to the treatment of COVID-19 patients.</p>

<p>The Cystatin C antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of life sciences. It is specifically designed to target and neutralize cystatin C, a chemokine growth factor that plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of cystatin C.</p>

Troponin I antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody specifically targets c-myc, a protein involved in cell growth and proliferation. It can be used for various applications, including research in cancer biology and immunology. The troponin I antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.

SQSTM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets TNF-α, collagen, and other proteins involved in various cellular processes. This neutralizing antibody can inhibit the activity of growth factors such as TGF-beta and promote lysis of targeted cells. SQSTM1 antibody has shown promising results in studies involving anti-ACTH antibodies, adalimumab, trastuzumab, and inhibitors of epidermal growth factor. Its specificity and effectiveness make it a valuable tool for researchers studying protein-protein interactions and investigating the role of certain proteins in disease pathways.

Streptococcus Pneumoniae antibody was raised in mouse using the Streptococcus pneumoniae common C-polysaccharide as the immunogen.

<p>Affinity purified goat polyclonal hCG alpha antibody</p>

<p>Mouse monoclonal hCG alpha antibody</p>

<p>Estrogen receptor antibody was raised in rabbit using a synthetic peptide from the N-Terminus of human estrogen receptor, alpha protein as the immunogen.</p>

<p>Goat anti-bovine IgG (H+L) (Rhodamine) was raised in goat using bovine IgG, whole molecule as the immunogen.</p>

<p>EPOr antibody was raised in sheep using partial cDNA of the extracellular domain of human EpoR expressed as a GST fusion protein in E. Coli as the immunogen.</p>

<p>CD235a antibody was raised in mouse using human erythrocytes as the immunogen.</p>

<p>Amitriptyline antibody was raised in mouse using amitriptyline conjugated to KLH as the immunogen.</p>

<p>RAP antibody was raised in rabbit using recombinant human RAP as the immunogen.</p>

Luteinizing Hormone antibody is a growth factor that plays a crucial role in various biological processes. It acts through the p38 mitogen-activated protein kinase pathway, which regulates cell proliferation, differentiation, and apoptosis. This cytotoxic antibody has been shown to inhibit the activity of luteinizing hormone, a glycoprotein hormone that stimulates the production of steroid hormones such as testosterone and progesterone.

<p>Goat polyclonal Human CRP antibody</p>

<p>Chlamydia trachomatis antibody (FITC) was raised in Mouse using LPS as the immunogen.</p>

<p>Troponin I antibody was raised in goat using purified human cardiac troponin I as the immunogen.</p>

<p>TSNAX antibody was raised in mouse using recombinant Human Translin-Associated Factor X</p>

Rabbit anti-sheep IgG (H+L) (Rhodamine) was raised in rabbit using sheep IgG whole molecule as the immunogen.

AGE antibody was raised in goat using glycoaldehyde-modified protein as the immunogen.

<p>Leu enkephalin antibody was raised in mouse using Leu5-enkephalin-BSA as the immunogen.</p>

<p>Donkey anti-rabbit IgG (H + L) (Fab'2) (Alk Phos) was raised in donkey using rabbit IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit polyclonal Ferritin antibody</p>

IL6 antibody (biotin) was raised in rabbit using highly pure recombinant rat IL-6 as the immunogen.

AFP antibody (HRP) was raised in mouse using human AFP from umbilical cord serum as the immunogen.

TSH antibody was raised in mouse using human TSH beta as the immunogen.

<p>Apo E antibody was raised in goat using Human Apolipoprotein E as the immunogen.</p>

Vimentin antibody was raised in mouse using Vimentin from cytoskeletal fraction of XLKE cells as the immunogen.

<p>Chlamydia trachomatis antibody was raised in goat using purified MOMP from strain L2 as the immunogen.</p>

<p>Luciferase antibody was raised in goat using highly purified firefly luciferase as the immunogen.</p>

<p>Goat polyclonal Human Complement C3 antibody (FITC)</p>

<p>Anti-VMP1 antibody</p>

CMV antibody was raised in mouse using glycoprotein gH as the immunogen.

<p>SLIT2</p>

<p>DNA antibody was raised in mouse using ds and ss DNA as the immunogen.</p>

<p>Cardiac Troponin I (cTnI) Rat Monoclonal Antibody, Recombinant</p>

<p>The α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) is an ionotropic transmembrane receptor for glutamate found throughout the central nervous system (CNS). AMPARs are composed of four types of subunits: GluR1/GluA1, GluR2/GluA2, GluR3/GluA3, and GluA4 (GluRA-D2), which combine to form heterotetramers.</p>

<p>Anti-Nocturnin antibody</p>

<p>The Goat anti Human IgE antibody is a highly specialized antibody that is designed to specifically target and bind to human IgE in various applications. This antibody is derived from goat serum and has been extensively tested for its specificity and sensitivity. It is commonly used in research and diagnostic laboratories for the detection and quantification of IgE levels in human serum samples.</p>

<p>Ubiquitin antibody was raised in mouse using purified bovine erythrocyte ubiquitin as the immunogen.</p>

<p>Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&amp;L) as the immunogen.</p>

<p>IL17E antibody was raised in rabbit using highly pure recombinant human IL-17E as the immunogen.</p>

<p>CRP antibody was raised in goat using Purified human CRP as the immunogen.C-Reactive Protein (CRP) is an acute-phase inflammatory, pentameric plasma protein. Awarded its name after being first discovered reacting with the capsular (C)-polysaccharide of the Pneumococcus infection, CRP has since been found to activate the classical complement pathway of innate immunity. Dependent on the presence of calcium ions on its ligand-binding face, CRP specifically stimulates C1q when binding to phosphocholine and other polysaccharides located on microorganisms. Expression of CRP is increased (primarily in the hepatocytes) when inflammatory cytokines such as interleukin-6 are elevated during infection and some conditions such as rheumatoid arthritis and cardiovascular diseases.</p>

HCG antibody is a monoclonal antibody that specifically targets human chorionic gonadotropin (HCG). It has been widely used in life sciences research to study various aspects of HCG function. This antibody can neutralize the activity of HCG by binding to it and preventing its interaction with its receptors. Additionally, it has been shown to inhibit the growth of endothelial cells and adipocytes, suggesting potential therapeutic applications in conditions such as obesity and angiogenesis-related disorders. Furthermore, HCG antibody can be used as a diagnostic tool for detecting the presence of HCG in clinical samples, making it valuable in pregnancy testing and monitoring certain types of cancer. Its specificity and high affinity make it an essential tool for researchers and clinicians working in the field of reproductive biology and endocrinology.

<p>IL1b antibody was raised in mouse using E. Coli-derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>

<p>Influenza B antibody was raised in mouse using a nuclear protein from the Singapore strain of influenza B as the immunogen.</p>

The E-Cadherin antibody is a highly effective and buffered solution that is used for various applications in the field of Life Sciences. This antibody specifically targets E-Cadherin expression, which plays a crucial role in cell-cell adhesion and maintaining tissue integrity.

Anti-HIV-1-p24 Mouse Monoclonal is a life science tool for use in IVD applications. Please enquire for more information about Anti-HIV-1-p24 Mouse Monoclonal including the price, delivery time and more detailed product information at the technical inquiry form on this page.