Primary Antibodies

<p>EPO antibody (HRP) was raised in mouse using human EPO as the immunogen.</p>

<p>The Glyphosate antibody is a monoclonal antibody that specifically targets and neutralizes glyphosate, a widely used herbicide. It has been shown to bind to glyphosate molecules and prevent their interaction with target proteins in plants. This antibody can be used in various applications, including research, agriculture, and environmental monitoring. The Glyphosate antibody has high affinity and specificity for glyphosate, making it a valuable tool for detecting and quantifying glyphosate residues in various samples such as water, soil, crops, and food products. Its use can contribute to the development of sustainable farming practices and the protection of human health and the environment.</p>

HSV1/HSV2 antibody was raised in rabbit using Strain F as the immunogen.

The Cystatin C antibody is a monoclonal antibody that exhibits cytotoxic properties. It specifically targets and binds to cystatin C, a low-molecular-weight protein that plays a role in inhibiting cysteine proteases. By neutralizing the activity of cystatin C, this antibody promotes the activation of cysteine proteases, which are involved in various cellular processes including apoptosis and cell proliferation.

The beta hCG antibody is a monoclonal antibody that has neutralizing properties against the epidermal growth factor. It also interacts with other proteins such as fibrinogen, phosphatase, and lipoprotein lipase. The beta hCG antibody can block the activation of TGF-beta, a key regulator of cell growth and differentiation. Additionally, this antibody can inhibit the activity of chemokines and growth factors involved in various cellular processes. The beta hCG antibody is widely used in Life Sciences research for its ability to target specific molecules and pathways. It is produced using advanced techniques and has high affinity due to its unique histidine composition. Experience the power of this highly specific monoclonal antibody for your research needs.

SQSTM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets TNF-α, collagen, and other proteins involved in various cellular processes. This neutralizing antibody can inhibit the activity of growth factors such as TGF-beta and promote lysis of targeted cells. SQSTM1 antibody has shown promising results in studies involving anti-ACTH antibodies, adalimumab, trastuzumab, and inhibitors of epidermal growth factor. Its specificity and effectiveness make it a valuable tool for researchers studying protein-protein interactions and investigating the role of certain proteins in disease pathways.

<p>Proinsulin antibody was raised in mouse using human proinsulin as the immunogen.</p>

<p>UCP2 antibody was raised in rabbit using a 13 amino acid peptide from mouse UCP2 as the immunogen.</p>

<p>Cyclin-dependent kinases (CDKs) are regulated by positive and negative phosphorylation. T14/Y15 phosphorylation by the WEE1 and MYT1 kinases inhibits CDKs by preventing ATP binding, and these conserved phosphorylations are highly regulated during the cell cycle and by signalling pathways. WEE1 and MYT1 are opposed by cell division cycle 25 (CDC25) phosphatases, which, in mammals, comprise three related enzymes that dephosphorylate T14/Y15 to promote CDK activity.</p>

<p>Monoclonal antibody against CD52; treatment for multiple sclerosis; anti-cancer</p>

<p>The MX1 antibody is a biomolecule used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the antigen known as TRPV4. This antibody has been extensively studied and proven to be effective in various applications, including research and diagnostics.</p>

Procalcitonin antibody is a monoclonal antibody that targets procalcitonin, a protein that is involved in various biological processes. This antibody is widely used in Life Sciences research to study the role of procalcitonin in endothelial growth, alpha-fetoprotein regulation, and other physiological functions. The high specificity and affinity of this monoclonal antibody make it an excellent tool for detecting and quantifying procalcitonin levels in various samples. It can be used in techniques such as immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), Western blotting, and flow cytometry. Additionally, this antibody can be conjugated with different labels or enzymes for easy detection and visualization. Whether you are studying procalcitonin's involvement in cancer, inflammation, or other diseases, this highly reliable and versatile antibody will provide accurate and reproducible results.

Presenilin 1 antibody was raised in goat using a synthetic peptide corresponding to amino acid residues 14-33 of the N-terminus of the alzheimer's disease presenilin-1 as the immunogen.

<p>Goat anti-human IgA was raised in goat using purified human IgA as the immunogen.</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

TFEB antibody was raised in mouse using recombinant Human Transcription Factor Eb (Tfeb)

Donkey anti Chicken IgY secondary antibody;(H + L) with AF594 photostable dye lable.

<p>TrkA antibody was raised in mouse using recombinant human TrkA extracellular domain as the immunogen.</p>

Please enquire for more information about Dengue Virus Type 2 NS1 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

IL1 beta antibody was raised using the N terminal of IL1B corresponding to a region with amino acids DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE

<p>Amitriptyline antibody was raised in mouse using amitriptyline conjugated to KLH as the immunogen.</p>

<p>Actin antibody was raised in mouse using N-terminal decapeptide of smooth muscle isoform of actin, acetylated at the N-terminus, as the immunogen.</p>

Mouse monoclonal Bt Cry1Ab/Ac antibody

Insulin antibody was raised in guinea pig using human Insulin as the immunogen.

EBV antibody (gp250/350) was raised in mouse using envelope glycoprotein complex 250/350 as the immunogen.

<p>Thyroxine antibody (Canine) was raised in mouse using Thyroxine (T4)-BSA as the immunogen.</p>

<p>The Zika virus NS1 antibody is a highly specific monoclonal antibody that targets the NS1 protein of the Zika virus. This antibody has been extensively studied and proven to be effective in detecting and neutralizing the Zika virus. It binds to the NS1 protein, preventing its interaction with host cells and inhibiting viral replication.</p>

Complement C3 antibody is a polyclonal antibody that specifically targets the complement component C3. This antibody is widely used in life sciences research to study the role of complement activation and its involvement in various physiological processes. Complement C3 plays a crucial role in the immune response, inflammation, and tissue homeostasis. The antibody has been shown to neutralize the activity of C3, inhibiting its function and preventing downstream effects such as the generation of pro-inflammatory cytokines like interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, this antibody can be utilized for genotoxic studies, as it has been shown to bind to plasmids and prevent their uptake into cells. The complement C3 antibody is a valuable tool for researchers studying complement biology, immune responses, and inflammatory processes.

E. coli O157 antibody was raised in mouse using the 'O' antigen of E. coli serotype O157 as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections and its ability to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. This drug has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

<p>Cortisol-3 antibody was raised in rabbit using cortisol-3-BSA as the immunogen.</p>

CA 125 antibody was raised in Mouse using affinity pure human CA 125 antigen as the immunogen.

<p>Complement C3 antibody is a highly specialized product designed to target and neutralize the complement protein C3. This antibody has been extensively tested and proven effective in laboratory studies. It has shown high affinity for C3 and can effectively block its activity.</p>

The Human Growth Hormone antibody is a glycosylated protein that plays a crucial role in endothelial growth and development. It acts as a growth factor and interacts with androgen receptors to regulate various physiological processes. The antibody specifically targets the human growth hormone, inhibiting its activity and preventing excessive growth.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. With its specific binding ability to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The efficacy of this drug has been demonstrated through extensive research using advanced techniques like patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

<p>The EpCAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the EpCAM antigen, a glycoprotein that is highly expressed in various types of cancer cells. This antibody can be used for a variety of applications, including research and diagnostics.</p>

<p>The RSAD2 antibody is a highly sensitive monoclonal antibody that is used for ultrasensitive detection of the growth factor. It specifically targets the RSAD2 molecule, making it an essential tool in Life Sciences research. This monoclonal antibody can be immobilized on an electrode surface for reactive and activated detection of the RSAD2 molecule. It has also been shown to have high affinity for other molecules such as erythropoietin receptor and collagen. In addition to its application in research, this antibody can be used for the detection of autoantibodies or as part of diagnostic tests in medical settings. Whether you need to study molecular interactions or develop diagnostic assays, the RSAD2 antibody is a valuable tool that delivers accurate and reliable results.</p>

<p>Collagen type I antibody was raised in rabbit using collagen type I from human and bovine placenta as the immunogen.</p>

<p>Fibrinogen antibody was raised in Rat using Fibrinogen purified from human blood containing alpha, beta and gamma chains as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Additionally, it undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains by binding to markers expressed at high levels in these strains.</p>

Influenza A antibody was raised in mouse using Influenza A as the immunogen.

Human IgA antibody was raised in sheep using human secretory piece purified from human colostrum as the immunogen.

Salmonella antibody was raised in mouse using salmonella flagellum protein as the immunogen.

HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.

Trypsin inhibitor antibody was raised in rabbit using trypsin inhibitor isolated from lima beans as the immunogen.

Human growth hormone antibody was raised in mouse using purified human growth hormone as the immunogen.

<p>BMP2/BMP4 antibody was raised in goat using recombinant human BMP-2 as the immunogen.</p>

Calmodulin antibody was raised in sheep using highly purified bovine testes calmodulin as the immunogen.

Rotavirus antibody was raised in mouse using Intact virus of strains RRV, WA and bovine as the immunogen.

<p>Phospho tau antibody was raised in mouse using human PHF-tau as the immunogen.</p>

<p>SLC30A8</p>

<p>MAP3K5</p>

Slc34a3

<p>TORC-2</p>

<p>Activin beta-A chain</p>

hCG Beta antibody was raised in Mouse using chorionic gonadotropin, B-subunit as the immunogen.

Nephrin antibody was raised in guinea pig using a synthetic peptide corresponding to residues 1243-1256 of the intracellular domain of nephrin as the immunogen.

human rhinovirus (HRV) VPg uridylylation.

<p>GLG1</p>

<p>SLC30A8</p>

<p>Vnn1</p>

<p>MAP3K5</p>

<p>Anti-NDI antibody</p>

<p>Activin beta-A chain</p>

<p>TORC-2</p>

<p>Anti-NDI antibody</p>

<p>TORC-2</p>

<p>MAP3K5</p>

<p>IL34</p>

CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.

<p>FCGR2A/C</p>

<p>Saposin A</p>

Parkin antibody was raised in goat using peptide (TGGDDPRNAAGGCER) as the immunogen.

PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA). PSA is a glycoprotein that is produced by the prostate gland and is commonly used as a biomarker for prostate cancer. This antibody can be used in various applications, such as immunoassays and immunohistochemistry, to detect and quantify PSA levels in human serum. The PSA antibody works by binding to the PSA antigen, which triggers a series of immune responses that ultimately lead to the lysis or destruction of cells expressing PSA. Additionally, this monoclonal antibody has antiangiogenic properties and can inhibit the growth factor signaling pathways, such as endothelial growth factor and β-catenin, which are involved in tumor angiogenesis. The use of PSA antibody in combination with other therapies, such as interferon, has shown promising results in preclinical studies for the treatment of prostate cancer.

FCGR2A/C

Keratin pan antibody was raised in rabbit using Keratin pan isolated from human skin as the immunogen.

<p>GLG1</p>

<p>Glut-4</p>

PrP 27-30 antibody was raised in goat using peptide (GQGGGTHSQWNKPSKPKTN) as the immunogen.

<p>Saposin A</p>

<p>Slc34a3</p>

<p>Cardiac Troponin I (cTnI) Mouse Monoclonal Antibody, Recombinant</p>

<p>Please enquire for more information about Anti-ANO1 antibody R2G - 1mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glut-4</p>

<p>IL12A</p>

<p>GRAF-1</p>

<p>human rhinovirus (HRV) VPg uridylylation.</p>

<p>GLG1</p>

<p>The ApoB antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. This antibody specifically targets and neutralizes interferon, TGF-beta, phosphatase, tyrosine, glutamate, and dopamine. It is widely used in the field of life sciences for research purposes.</p>

<p>FCGR3B</p>

<p>Complement C4 antibody was raised in goat using human C4 complement as the immunogen.</p>

<p>TORC-2</p>

<p>GLG1</p>

<p>Glut-4</p>

<p>Please enquire for more information about Anti-ANO1 antibody R1T - 0.4mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRAF-1</p>

<p>TGF alpha antibody was raised in mouse using 17-amino acid synthetic peptide from carboxyl-terminus of rat TGF-alpha as the immunogen.</p>

<p>Hepatitis C Virus antibody is a highly valuable product in the field of Life Sciences. This antibody specifically targets the Hepatitis C Virus, an infectious agent that causes liver inflammation and disease. It is commonly used in research and diagnostic applications to detect the presence of Hepatitis C Virus in patient samples.</p>

<p>Presenilin 1 antibody was raised in goat using peptide (AQMSEDNHLSNTVRSQNDNR) as the immunogen.</p>