Primary Antibodies

<p>EDN2 antibody was raised in Rabbit using Human EDN2 as the immunogen</p>

<p>Salmonella antibody (biotin) was raised in rabbit using a mixture of S. enteriditis, S. typhimurium and S. heidelburg as the immunogen.</p>

<p>Rabbit polyclonal ARTS1 antibody</p>

<p>Purified Polyclonal RAB30 antibody</p>

<p>FBXW7 antibody was raised using the C terminal of FBXW7 corresponding to a region with amino acids  LKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL</p>

<p>CD31 antibody was raised in mouse using stimulated human Leukocytes as the immunogen.</p>

<p>ACVRL1 antibody was raised in Rabbit using Human ACVRL1 as the immunogen</p>

<p>Purified Rabbit polyclonal HER3 antibody (Tyr1197)</p>

<p>CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA</p>

<p>ACSM3 antibody was raised in Rabbit using Human ACSM3 as the immunogen</p>

<p>The STEAP1 antibody is a highly effective and activated agent that plays a crucial role in various biological processes. It specifically targets vitronectin, an extracellular matrix protein involved in cell adhesion and migration. The STEAP1 antibody has been extensively studied for its ability to neutralize the effects of autoantibodies, which can lead to autoimmune diseases.</p>

<p>Affinity purified Rabbit polyclonal Deltex1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HOXB9 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to HOXB9, a protein involved in various biological processes such as collagen synthesis and glycosylation. By inhibiting the activity of HOXB9, this antibody can be used to study its function and impact on cellular processes.</p>

<p>Rabbit polyclonal Beta Enolase antibody</p>

<p>Purified Rabbit polyclonal MPRIP antibody</p>

<p>C4d Complement fragment Monoclonal Antibody</p>

<p>LHRH Antibody is a monoclonal antibody that specifically targets luteinizing hormone-releasing hormone (LHRH). It has been shown to inhibit the activity of LHRH, which plays a crucial role in regulating reproductive functions. This antibody has interferon-like activity and can modulate the release of vasoactive intestinal peptide and colony-stimulating factors. Additionally, it has been demonstrated to enhance the production of interferon-gamma (IFN-gamma) in human serum. LHRH Antibody may also have potential therapeutic applications in the treatment of conditions such as prostate cancer and breast cancer, as it can interfere with the growth-promoting effects of LHRH on tumor cells.</p>

<p>DIRAS3 antibody was raised in Rabbit using Human DIRAS3 as the immunogen</p>

<p>Rabbit polyclonal Ceruloplasmin antibody (FITC)</p>

<p>CMV antibody (FITC) was raised in goat using purified virions of strain AD169 as the immunogen.</p>

<p>DNAI1 antibody was raised in Rabbit using Human DNAI1 as the immunogen</p>

<p>The NOS3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the NOS3 protein, also known as endothelial nitric oxide synthase. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>FAM121B antibody was raised using the N terminal Of Fam121B corresponding to a region with amino acids PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL</p>

<p>Purified Polyclonal LYAR antibody</p>

<p>The cRel antibody is a highly specialized monoclonal antibody that targets the cRel protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The cRel antibody specifically binds to the glutamate residues of the cRel protein, which plays a crucial role in regulating gene expression and immune response.</p>

<p>CDK2AP1 antibody was raised in Rabbit using Human CDK2AP1 as the immunogen</p>

<p>Purified Polyclonal LRAT antibody</p>

<p>KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF</p>

<p>PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR</p>

<p>Rabbit Polyclonal IGF1R antibody (Tyr1161)</p>

<p>Rabbit polyclonal GRM5 antibody</p>

<p>Rabbit polyclonal CHRM4 antibody</p>

<p>EPS15L1 antibody was raised in Rabbit using Human EPS15L1 as the immunogen</p>

<p>Purified Polyclonal NDUFA4L2 antibody</p>

<p>RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN</p>

<p>SMPX antibody was raised using the middle region of SMPX corresponding to a region with amino acids TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ</p>

<p>The MVD antibody is a highly specialized monoclonal antibody that targets the protein MVD (mevalonate diphosphate decarboxylase). This antibody is commonly used in Life Sciences research to study the function and regulation of MVD in various biological processes. It has been shown to interact with interleukin-6, chemokines, and nuclear proteins, indicating its involvement in immune responses and cellular signaling pathways.</p>

<p>The IGF1R antibody is a growth factor that belongs to the class of monoclonal antibodies. It is similar to trastuzumab and other antibodies in its ability to target specific proteins and inhibit their activity. The IGF1R antibody specifically targets the insulin-like growth factor 1 receptor (IGF1R), which plays a crucial role in cell proliferation, differentiation, and survival. By binding to IGF1R, this antibody prevents the activation of downstream signaling pathways, thereby inhibiting tumor growth.</p>

<p>COX4I1 antibody was raised using the N terminal of COX4I1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK</p>

<p>AES antibody was raised using the C terminal of AES corresponding to a region with amino acids GLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD</p>

<p>CNOT7 antibody was raised in Rabbit using Human CNOT7 as the immunogen</p>

<p>The NF kappaB p65 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It is designed to specifically bind to the NF kappaB p65 protein, which plays a critical role in regulating gene expression and cellular processes. This antibody has been extensively tested and validated for its receptor binding activity in human serum.</p>

<p>Rabbit polyclonal SCAND1 antibody</p>

<p>Purified Polyclonal MED15 antibody</p>

<p>Rabbit polyclonal TAS2R8 antibody</p>

<p>Rabbit Polyclonal FLT3 antibody (Tyr591)</p>

<p>Purified Polyclonal DUSP16 antibody</p>

<p>CD72.1 antibody was raised in mouse using DBA/2 murine spleen cells as the immunogen.</p>

<p>The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.</p>

<p>Rabbit polyclonal MYST1 antibody</p>

<p>C6ORF134 antibody was raised using the middle region of C6Orf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID</p>

<p>FLOT1 antibody was raised in Rabbit using Human FLOT1 as the immunogen</p>

<p>ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV</p>

<p>APLP2 antibody was raised in Rabbit using Human APLP2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal PRPS2 antibody</p>

<p>Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL</p>

<p>Lamin A+C Monoclonal Antibody</p>

<p>hnRNP A2B1 Monoclonal Antibody</p>

<p>MESP1 antibody was raised in rabbit using the N terminal of MESP1 as the immunogen</p>

<p>Rabbit polyclonal FGF21 antibody (biotin)</p>

<p>REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT</p>

<p>The HSPG2 antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively studied for its role in osteopontin regulation and e-cadherin expression. Additionally, this antibody has shown potential in targeting amyloid plaque formation and inhibiting oncostatin activity.</p>

<p>NINJ2 antibody was raised in Rabbit using Human NINJ2 as the immunogen</p>

<p>Rabbit polyclonal ZNF397 antibody</p>

<p>APOBEC4 antibody was raised in Rabbit using Human APOBEC4 as the immunogen</p>

<p>ABHD14B antibody was raised in Rabbit using Human ABHD14B as the immunogen</p>

<p>NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV</p>

<p>The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.</p>

<p>The HDAC1 antibody is a highly specialized product in the field of Life Sciences. It is a glycopeptide that specifically targets and binds to the HDAC1 protein, which plays a crucial role in gene expression regulation. This antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific experimental needs.</p>

<p>CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL</p>

<p>The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.</p>

<p>Affinity purified Rabbit polyclonal BCLx antibody</p>

<p>Rabbit polyclonal ZNF23 antibody</p>

<p>Rabbit polyclonal OR10A5 antibody</p>

<p>CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal HHIP antibody</p>

<p>Rabbit polyclonal Caldesmon antibody (Ser759)</p>

<p>AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK</p>

<p>The p90RSK antibody is a cytotoxic monoclonal antibody that targets the p90 ribosomal S6 kinase (p90RSK). It is commonly used in research to study growth factors, such as hepatocyte growth factor. This antibody has been shown to inhibit the activity of p90RSK, which is involved in multiple cellular processes including cell proliferation and survival. The p90RSK antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It has also been shown to bind to other proteins such as collagen, creatine kinase, fibronectin, and retinoid receptors. This antibody may have potential therapeutic applications due to its ability to target specific proteins involved in disease pathways.</p>

<p>Purified Polyclonal GPR82 antibody</p>

<p>Affinity purified Rabbit polyclonal MUS81 antibody</p>

<p>CD8 antibody (PE) was raised in mouse using feline CD8 as the immunogen.</p>

<p>ALDH8A1 antibody was raised in Rabbit using Human ALDH8A1 as the immunogen</p>

<p>The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.</p>

<p>Rabbit polyclonal DAD1 antibody (biotin)</p>

<p>HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS</p>

<p>Rabbit polyclonal RPL8 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal RBPJ kappa antibody</p>

The CtBP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets CtBP2, a protein involved in various cellular processes such as epidermal growth factor signaling and regulation of β-catenin. This antibody is designed to recognize and bind to CtBP2 with high affinity, making it an essential tool for studying the function and localization of this protein.

<p>Affinity purified Rabbit polyclonal MCH1R antibody</p>

<p>ERBB4 antibody was raised in Rabbit using Human ERBB4 as the immunogen</p>

<p>Rabbit polyclonal iNOS antibody (Tyr151)</p>

<p>Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.</p>

<p>EPB41 antibody was raised in Rabbit using Human EPB41 as the immunogen</p>

<p>The TFEB antibody is a versatile and powerful tool in the field of Life Sciences. It is an antiviral and natriuretic antibody that specifically targets brain natriuretic peptide (BNP). This antibody can be used for various applications, including electrophoresis, where it can detect BNP in human serum samples. Additionally, the TFEB antibody has been shown to have chemokine activity, making it an excellent choice for studying immune responses.</p>

<p>Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids  PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW</p>

<p>Rabbit polyclonal RAD23A antibody (HRP)</p>

<p>ABAT antibody was raised in Rabbit using Human ABAT as the immunogen</p>

<p>Rabbit polyclonal NADAP antibody</p>