Primary Antibodies

<p>GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA</p>

<p>B4galt5 antibody was raised in rabbit using the C terminal of B4galt5 as the immunogen</p>

<p>IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL</p>

<p>CBLL1 antibody was raised in rabbit using the N terminal of CBLL1 as the immunogen</p>

<p>ARL8A antibody was raised using the middle region of ARL8A corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ</p>

<p>The MEF2A antibody is a monoclonal antibody that specifically targets the endogenous protein kinase MEF2A. This antibody can be used to detect and quantify the activation of MEF2A in various cell lines and tissues. It has been shown to have specific reactivity with the target molecule, making it a reliable tool for studying the function of MEF2A in cellular processes.</p>

<p>SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEV</p>

<p>ZFP106 antibody was raised in rabbit using the N terminal of ZFP106 as the immunogen</p>

<p>ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen</p>

<p>Bnc1 antibody was raised in rabbit using the C terminal of Bnc1 as the immunogen</p>

<p>TP53INP2 antibody was raised in rabbit using the C terminal of TP53INP2 as the immunogen</p>

<p>PQLC2 antibody was raised using the middle region of PQLC2 corresponding to a region with amino acids LLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQEVIGF</p>

<p>Sh3glb1 antibody was raised in rabbit using the N terminal of Sh3glb1 as the immunogen</p>

<p>FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA</p>

<p>PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI</p>

<p>Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL</p>

<p>GHRHR antibody was raised using the middle region of GHRHR corresponding to a region with amino acids PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR</p>

<p>TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP</p>

<p>TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR</p>

<p>GTF3C5 antibody was raised in rabbit using the C terminal of GTF3C5 as the immunogen</p>

<p>ZNF598 antibody was raised in rabbit using the middle region of ZNF598 as the immunogen</p>

<p>TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.</p>

<p>Pcyt2 antibody was raised in rabbit using the N terminal of Pcyt2 as the immunogen</p>

<p>NNT1 antibody was raised in rabbit using highly pure recombinant human NNT-1/BCSF-3 as the immunogen.</p>

<p>ZNF275 antibody was raised in rabbit using the N terminal of ZNF275 as the immunogen</p>

<p>CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA</p>

<p>GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF</p>

<p>ATP5G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA</p>

<p>Purified Polyclonal M Cadherin antibody</p>

<p>CCRD6 antibody was raised in goat using a synthetic peptide C-L10ATEDADSENSSFYYYDYLDEVAFM35L corresponding to the N-terminal extracellular domain of human D6 as the immunogen.</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDH</p>

<p>IL1F5 antibody was raised in rabbit using the middle region of IL1F5 as the immunogen</p>

<p>SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL</p>

<p>B4GALNT3 antibody was raised using the N terminal of B4GALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA</p>

<p>C3orf31 antibody was raised in rabbit using the middle region of C3ORF31 as the immunogen</p>

<p>SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP</p>

<p>TMEM107 antibody was raised in rabbit using the N terminal of TMEM107 as the immunogen</p>

<p>IL10 antibody is a highly specialized monoclonal antibody that targets the protein interleukin-10 (IL-10). IL-10 is an important anti-inflammatory cytokine that plays a crucial role in regulating immune responses. This antibody specifically binds to IL-10, preventing its interaction with its receptors and inhibiting its biological activity.</p>

<p>MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF</p>

<p>ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogen</p>

<p>ZNF785 antibody was raised in rabbit using the N terminal of ZNF785 as the immunogen</p>

<p>SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV</p>

<p>Aak1 antibody was raised in rabbit using the C terminal of Aak1 as the immunogen</p>

<p>2610034B18Rik antibody was raised in rabbit using the N terminal of 2610034B18Rik as the immunogen</p>

<p>OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL</p>

<p>Angiopoietin 2 antibody was raised in rabbit using 20-aa peptide from mouse Ang-2 as the immunogen.</p>

<p>Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG</p>

<p>UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV</p>

<p>Scg3 antibody was raised in rabbit using the C terminal of Scg3 as the immunogen</p>

<p>GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE</p>

<p>ZNF548 antibody was raised in rabbit using the C terminal of ZNF548 as the immunogen</p>

<p>Ubxn2a antibody was raised in rabbit using the middle region of Ubxn2a as the immunogen</p>

<p>ZNF138 antibody was raised in rabbit using the C terminal of ZNF138 as the immunogen</p>

<p>ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE</p>

<p>ZBTB32 antibody was raised in rabbit using the N terminal of ZBTB32 as the immunogen</p>

<p>ZNF474 antibody was raised in rabbit using the middle region of ZNF474 as the immunogen</p>

<p>APLNR antibody was raised in rabbit using the N terminal of APLNR as the immunogen</p>

<p>GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ</p>

<p>PCSK6 antibody was raised in rabbit using the N terminal of PCSK6 as the immunogen</p>

<p>TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>Purified Polyclonal MRPL16 antibody</p>

<p>SLC6A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW</p>

<p>Eotaxin 2 antibody was raised in goat using highly pure recombinant human eotaxin-2 as the immunogen.</p>

<p>CCDC110 antibody was raised in rabbit using the middle region of CCDC110 as the immunogen</p>

<p>GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN</p>

<p>Purified Polyclonal ZNF174 antibody</p>

<p>Fggy antibody was raised in rabbit using the N terminal of Fggy as the immunogen</p>

<p>MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA</p>

<p>TLK2 antibody was raised in rabbit using the N terminal of TLK2 as the immunogen</p>

<p>PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK</p>

<p>LOXL1 antibody was raised using the N terminal of LOXL1 corresponding to a region with amino acids RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR</p>

<p>ZNF251 antibody was raised in rabbit using the middle region of ZNF251 as the immunogen</p>

<p>UBE2F antibody was raised in rabbit using the middle region of UBE2F as the immunogen</p>

<p>PSMD9 antibody was raised in rabbit using the C terminal of PSMD9 as the immunogen</p>

<p>RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST</p>

<p>Twf1 antibody was raised in rabbit using the C terminal of Twf1 as the immunogen</p>

<p>AKAP8 antibody was raised in rabbit using the middle region of AKAP8 as the immunogen</p>

<p>LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT</p>

<p>Cacng1 antibody was raised in rabbit using the middle region of Cacng1 as the immunogen</p>

<p>ZER1 antibody was raised in rabbit using the middle region of ZER1 as the immunogen</p>

<p>RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI</p>

<p>PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL</p>

<p>MMP19 antibody was raised in rabbit using a synthetic peptide corresponding to a region of human MMP-19 as the immunogen.</p>

<p>Gelsolin antibody was raised using a synthetic peptide corresponding to a region with amino acids KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN</p>

<p>UNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS</p>

<p>ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL</p>

<p>CHRFAM7A antibody was raised using the N terminal of CHRFAM7A corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC</p>

<p>The Biotin antibody is a polyclonal antibody that specifically binds to biotin. It has a high affinity for biotin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA. This antibody is commonly used in life sciences research to detect and visualize biotinylated molecules or to amplify signals in assays. It can also be used in conjunction with streptavidin-conjugated enzymes or fluorochromes for detection purposes. The Biotin antibody is highly specific and sensitive, making it an essential tool for researchers working with biotinylation techniques or studying the role of biotin in biological processes.</p>

<p>SMPD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRESLV</p>

<p>TP53BP2 antibody was raised in rabbit using the N terminal of TP53BP2 as the immunogen</p>

<p>SLC17A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS</p>

<p>RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF</p>

<p>PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV</p>

<p>FGD1 antibody was raised in rabbit using the C terminal of FGD1 as the immunogen</p>

<p>RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen</p>

<p>ADD3 antibody was raised in rabbit using the middle region of ADD3 as the immunogen</p>