Primary Antibodies

<p>Affinity purified Rabbit polyclonal NAT2 antibody</p>

<p>Affinity purified Rabbit polyclonal Adenosine A2AR antibody</p>

<p>CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD</p>

<p>Mouse monoclonal Thyroglobulin antibody (Prediluted for IHC)</p>

<p>The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>The OLR1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and neutralize collagen autoantibodies, as well as TNF-α (tumor necrosis factor-alpha). This specific antibody has a unique structure with EGF-like domains that allow it to bind to activated fibronectin and epidermal growth factor. Additionally, it has been shown to have a high affinity for TGF-beta and various chemokines. The OLR1 antibody is an essential tool for researchers studying the role of these molecules in different biological processes. With its specificity and effectiveness, this polyclonal antibody is a valuable asset in scientific studies and experiments.</p>

<p>The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.</p>

<p>Purified Polyclonal SEI1 antibody</p>

Affinity purified Rabbit polyclonal ER beta antibody

<p>NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS</p>

<p>Purified Rabbit polyclonal TR beta antibody (Ser142)</p>

Rabbit polyclonal GRIN2B antibody

<p>KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI</p>

<p>Affinity purified Chicken Polyclonal Clostridium Botulinum A Toxoid antibody, Anti-Clostridium Botulinum A Toxoid antibody</p>

<p>The E2A antibody is a high polymer monoclonal antibody that exhibits excellent pharmacokinetic properties. It is derived from human proteins and contains acid residues and disulfide bonds, ensuring its stability and effectiveness. This antibody specifically targets growth factors and can be used in various immunoassays and research applications.</p>

<p>The RCC2 antibody is a polyclonal antibody that specifically targets the protein RCC2. It is commonly used in research and life sciences to study various cellular processes and functions. RCC2 plays a crucial role in cell division, as it regulates the assembly and disassembly of the mitotic spindle during mitosis. This antibody can be used to detect RCC2 levels in different tissues and cells, providing valuable insights into its function and potential therapeutic applications.</p>

<p>FGFBP2 antibody was raised in Rabbit using Human FGFBP2 as the immunogen</p>

<p>The GM2A antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It can be used to detect and measure the levels of creatine kinase and phosphatase, which are important enzymes involved in cellular metabolism. Additionally, this antibody can be used for research involving mesenchymal stem cells, as it can help identify and characterize these cells. The GM2A antibody can also be used in electrode-based assays to study glucose-6-phosphate metabolism and collagen synthesis. In the medical field, this antibody has potential applications in diagnostics and therapeutics, particularly in the detection and treatment of diseases such as cancer. It has been shown to have binding affinity towards sorafenib, a drug used in the treatment of liver cancer. Furthermore, the GM2A antibody can be utilized to measure hepatocyte growth factor levels in human serum samples. Overall, this versatile antibody offers researchers and clinicians a valuable tool for studying various biological processes and developing innovative treatments.</p>

<p>Rabbit polyclonal CNOT2 antibody (Ser101)</p>

<p>Rabbit polyclonal RPL27 antibody (FITC)</p>

<p>Purified Polyclonal TERF1 antibody</p>

<p>FLASH antibody was raised in rabbit using N terminus of the FLASH protein as the immunogen.</p>

<p>Purified Polyclonal COPS3 antibody</p>

<p>Rabbit polyclonal NOP58 antibody</p>

<p>Biotin antibody (HRP)</p>

<p>The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.</p>

<p>Purified Rabbit polyclonal MYB73 antibody</p>

<p>Rabbit Polyclonal Raf1 antibody (Ser338)</p>

<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP</p>

<p>Affinity purified Rabbit polyclonal ABCD2 antibody</p>

<p>Mouse monoclonal RGS5 antibody</p>

<p>PRR13 antibody was raised using the middle region of PRR13 corresponding to a region with amino acids PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP</p>

<p>Affinity purified Rabbit polyclonal PSCDBP antibody</p>

<p>IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT</p>

<p>IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine involved in various immune responses. IL-6 plays a crucial role in inflammation, autoimmune disorders, and cancer progression. The IL6 antibody binds to IL-6, neutralizing its activity and preventing it from binding to its receptors.</p>

<p>Purified Polyclonal NOC3L antibody</p>

<p>Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE</p>

<p>KCND2 antibody was raised using the middle region of KCND2 corresponding to a region with amino acids RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL</p>

<p>Rabbit polyclonal CYC1 antibody (HRP)</p>

<p>The Adenovirus antibody is a monoclonal antibody that specifically targets and binds to adenoviruses. This antibody is commonly used in life sciences research and diagnostic applications. It has a high affinity for the adenovirus surface antigen, allowing for accurate detection and quantification of adenovirus infections. Additionally, the Adenovirus antibody can be used in immunofluorescence assays to visualize viral particles within infected cells. Its specificity and sensitivity make it a valuable tool in understanding the pathogenesis of adenoviral infections and developing effective treatments.</p>

<p>Rabbit polyclonal CNR1 antibody</p>

<p>Purified Polyclonal SMG7 antibody</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody</p>

<p>STYK1 antibody was raised in Mouse using a purified recombinant fragment of STYK1 expressed in E. coli as the immunogen.</p>

<p>HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE</p>

<p>SP1 antibody was raised using the middle region of SP1 corresponding to a region with amino acids TLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGL</p>

<p>ALG1 antibody was raised in Rabbit using Human ALG1 as the immunogen</p>

<p>NAPA antibody was raised in Rabbit using Human NAPA as the immunogen</p>

<p>ARMC10 antibody was raised in Rabbit using Human ARMC10 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Tetraspan 1 antibody</p>

<p>Rabbit polyclonal Gamma enolase antibody</p>

<p>RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK</p>

<p>CD28 antibody (Azide free) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>CD320 antibody was raised in Rabbit using Human CD320 as the immunogen</p>

<p>FXYD5 antibody was raised in Rabbit using Human FXYD5 as the immunogen</p>

<p>WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA</p>

<p>RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK</p>

<p>IL10 antibody (biotin) was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.</p>

<p>CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.</p>

<p>TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT</p>

<p>The ERG antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the ERG protein, which plays a critical role in cellular processes such as collagen production and TGF-beta1 signaling. This antibody can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The ERG antibody is designed to provide accurate and reliable results, ensuring the highest level of specificity and sensitivity. It can be used with various enzyme substrates and detection systems to achieve optimal performance. Whether you are studying cell signaling pathways or investigating disease mechanisms, the ERG antibody is an invaluable tool for your research needs. With its exceptional quality and performance, this antibody will help advance your scientific discoveries in the field of Life Sciences.</p>

<p>Purified Polyclonal EPS8L3 antibody</p>

<p>AKR1C1 antibody was raised in rabbit using the N terminal of AKR1C1 as the immunogen</p>

<p>Goat anti Pig IgM secondary antibody (Alk Phos)</p>

<p>Rabbit polyclonal Myelodysplasia Syndrome 1 antibody</p>

<p>UBE2O antibody was raised using the middle region of UBE2O corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR</p>

<p>Arginase 1 antibody was raised using the N terminal of ARG1 corresponding to a region with amino acids HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK</p>

<p>The CD318 antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and is commonly used for antibody-drug conjugates. This antibody specifically targets the CD20 protein, which is found on the surface of certain cells. CD318 antibodies have been extensively researched and are known for their ability to inhibit the growth and proliferation of these cells.</p>

<p>ADH1A antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA</p>

<p>DRG2 antibody was raised in Rabbit using Human DRG2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal cGK1 alpha antibody</p>

<p>Affinity purified Rabbit polyclonal XPNPEP2 antibody</p>

<p>Purified Polyclonal NEIL3 antibody</p>

<p>The UBE2L3 antibody is a highly specialized antibody used in life sciences research. It is designed to target and bind to the UBE2L3 protein, which plays a crucial role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>

<p>TBCD antibody was raised in rabbit using the N terminal of TBCD as the immunogen</p>

<p>Rabbit polyclonal HP1 alpha antibody</p>

<p>HCCS antibody was raised in rabbit using the N terminal of HCCS as the immunogen</p>

<p>Rabbit Polyclonal RelB antibody (Ser552)</p>

<p>WDR83 antibody was raised in rabbit using the C terminal of WDR83 as the immunogen</p>

<p>The IDO2 antibody is a highly specialized monoclonal antibody that targets the indoleamine 2,3-dioxygenase 2 (IDO2) protein. This antibody specifically recognizes and binds to IDO2, inhibiting its activity. IDO2 is an enzyme involved in the metabolism of tryptophan, an essential amino acid. By inhibiting IDO2, this antibody helps regulate the levels of tryptophan and other metabolites in various biological processes.</p>

<p>The MX1 antibody is a polyclonal antibody that has neutralizing properties against the virus surface antigen. It is commonly used in life sciences research to study the anticoagulant and chemokine functions of MX1. This antibody can be used in various applications, including mass spectrometric methods and protein kinase assays. It has been shown to effectively inhibit the activation of protein kinase 3-kinase in human serum. The MX1 antibody is a valuable tool for researchers studying interferon-related pathways and viral infections.</p>

<p>Rabbit polyclonal BCAP31 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its effectiveness has been demonstrated through various techniques such as the patch-clamp technique on human erythrocytes. This drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>SORD antibody was raised in rabbit using the N terminal of SORD as the immunogen</p>

<p>CEL antibody was raised in Rabbit using Human CEL as the immunogen</p>

<p>PDGF AA antibody was raised in rabbit using highly pure recombinant human PDGF-AA as the immunogen.</p>

<p>Rabbit polyclonal Galectin 7 antibody (FITC)</p>

<p>The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.</p>

<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal PEX19 antibody</p>

<p>Rabbit polyclonal PAK5/6 antibody</p>

<p>Purified Polyclonal WFS1 antibody</p>

<p>Affinity purified Rabbit polyclonal ADAMTSL2 antibody</p>

<p>ARMCX2 antibody was raised in Rabbit using Human ARMCX2 as the immunogen</p>

<p>GOT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA</p>

<p>Rabbit polyclonal Oncostatin M antibody (biotin)</p>

<p>The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.</p>

<p>Rabbit polyclonal Basigin antibody (HRP)</p>

<p>FGFR1OP antibody was raised using the N terminal of FGFR1OP corresponding to a region with amino acids FLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLE</p>

<p>C6ORF173 antibody was raised using the N terminal Of C6Orf173 corresponding to a region with amino acids ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV</p>