Primary Antibodies

<p>DUSP4 antibody was raised in Rabbit using Human DUSP4 as the immunogen</p>

<p>The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.</p>

<p>The SDS antibody is a highly specialized product used in the field of Life Sciences. It is an antibody specifically designed to target and detect insulin, a hormone crucial for regulating blood sugar levels. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in various research applications.</p>

<p>The Focal Adhesion Kinase antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in endothelial growth and has been extensively studied for its involvement in various cellular processes. This monoclonal antibody specifically targets the tyrosine residues of Focal Adhesion Kinase, inhibiting its activity and preventing downstream signaling events.</p>

<p>Rabbit polyclonal OR3A2 antibody</p>

<p>BXDC1 antibody was raised in Rabbit using Human BXDC1 as the immunogen</p>

<p>The Serpin B5 antibody is a glycoprotein that belongs to the family of Polyclonal Antibodies. It is widely used in Life Sciences as an inhibitor of various proteins and enzymes. This antibody specifically targets Serpin B5, also known as Maspin, which plays a crucial role in tumor suppression and metastasis. The immobilized Serpin B5 antibody can be used for various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It is also compatible with other antibodies, such as anti-CD20 antibodies or monoclonal antibodies, allowing for versatile experimental designs. Whether you are studying protein-protein interactions or developing antibody-drug conjugates, the Serpin B5 antibody is an essential tool in your research arsenal.</p>

<p>NDUFAF1 antibody was raised in Rabbit using Human NDUFAF1 as the immunogen</p>

<p>EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD</p>

<p>LIMA1 antibody was raised in Rabbit using Human LIMA1 as the immunogen</p>

<p>C14orf94 antibody was raised in Rabbit using Human C14orf94 as the immunogen</p>

<p>Rabbit polyclonal SPRY3 antibody</p>

<p>The MEK1 antibody is a highly specialized antibody that targets the amyloid protein and is activated in the presence of this specific protein. It belongs to the class of anti-beta amyloid antibodies and has been extensively studied in the field of Life Sciences. This antibody has shown neuroprotective properties and has been found to neutralize the harmful effects of beta amyloid on brain cells.</p>

<p>The RNASE1 antibody is a monoclonal antibody that specifically targets and binds to RNASE1, an enzyme involved in the breakdown of RNA molecules. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas.</p>

<p>Affinity purified Rabbit polyclonal TMED9 antibody</p>

<p>ATAD1 antibody was raised in rabbit using the C terminal of ATAD1 as the immunogen</p>

<p>The NTRK2 antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is an antibody that specifically targets and binds to the NTRK2 protein, which is involved in various cellular processes. This polyclonal antibody can be used for research purposes, such as studying the function and expression of NTRK2 in different cell types and tissues.</p>

<p>ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ</p>

<p>MYH14 antibody was raised in Rabbit using Human MYH14 as the immunogen</p>

<p>The RAMP2 antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It has been extensively studied for its ability to inhibit the activity of hydrogen fluoride, glucose-6-phosphate, and other test compounds. This antibody is known for its exceptional binding affinity to specific polymers and can be used as a powerful tool in various research studies.</p>

<p>FLYWCH1 antibody was raised in rabbit using the C terminal of FLYWCH1 as the immunogen</p>

<p>Purified Rabbit polyclonal FGFR1 antibody (Tyr766)</p>

<p>Rabbit polyclonal LRAT antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, it binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers highly expressed in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture</p>

<p>Rabbit polyclonal NDUFA1 antibody</p>

<p>Lp-PLA2 antibody is a powerful tool in the field of Life Sciences. It specifically targets lipoprotein-associated phospholipase A2 (Lp-PLA2), an enzyme that plays a crucial role in the metabolism of fatty acids. By inhibiting Lp-PLA2, this antibody helps regulate chemokine levels, reducing inflammation and improving overall vascular health.</p>

<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK</p>

<p>Mouse monoclonal CD229 antibody (allophycocyanin)</p>

<p>Mouse monoclonal Aeromonas caviae antibody</p>

<p>FNDC3B antibody was raised using the N terminal of FNDC3B corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP</p>

<p>The IDS antibody is a specific antibody widely used in Life Sciences research. It is commonly used for the detection and analysis of various proteins, including those involved in cellular signaling pathways, gene expression, and disease biomarkers. The IDS antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>The WFDC2 antibody is a highly specialized monoclonal antibody that targets specific molecules involved in various biological processes. It has been extensively studied in the field of life sciences and has shown great potential in different applications.</p>

<p>CRY2 antibody was raised in Rabbit using Human CRY2 as the immunogen</p>

<p>SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD</p>

<p>CD24 antibody (Azide free) was raised in rat using murine heat stable antigen as the immunogen.</p>

<p>Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL</p>

<p>Rabbit polyclonal MIF antibody (FITC)</p>

<p>SMAD1 antibody was raised in mouse using recombinant Human Smad Family Member 1 (Smad1)</p>

<p>Mouse Monoclonal HIV1 integrase Antibody; immunogen bacterially expressed, hexahistidine amino-terminal tagged HIV-1 integrase (IN) protein (clade B, HXB-3 isolate)</p>

<p>CDH16 antibody was raised in Rabbit using Human CDH16 as the immunogen</p>

<p>DO-11.10 T cell Receptor Monoclonal Antibody</p>

<p>Rabbit polyclonal TNR16 antibody</p>

<p>The Naproxen antibody is a polyclonal antibody used in life sciences research. It specifically targets and binds to Naproxen, a nonsteroidal anti-inflammatory drug (NSAID) commonly used for pain relief and reducing inflammation. This antibody can be used in various applications, including enzyme-linked immunosorbent assays (ELISA), Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The HER4 antibody is a highly effective therapeutic agent that belongs to the class of agonist proteins. It is a monoclonal antibody that specifically targets the HER4 receptor, which plays a crucial role in cell growth and development. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY</p>

<p>PEG10 antibody was raised in Mouse using a purified recombinant fragment of human PEG10 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>Affinity purified Rabbit polyclonal PSME3 antibody</p>

<p>FAM83F antibody was raised using the middle region of FAM83F corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP</p>

<p>Rabbit polyclonal Actin pan antibody</p>

<p>Purified Polyclonal GNG8 antibody</p>

<p>Affinity purified Goat polyclonal Eotaxin 3 antibody</p>

<p>Rabbit polyclonal RAC2 antibody</p>

<p>Rabbit polyclonal CSTL1 antibody</p>

<p>Affinity purified Rabbit polyclonal ZNF313 antibody</p>

<p>Rabbit polyclonal NDUC2 antibody</p>

<p>ANTXR1 antibody was raised in Rabbit using Human ANTXR1 as the immunogen</p>

<p>STX2 antibody was raised in rabbit using the N terminal of STX2 as the immunogen</p>

<p>M13/fd/F1 filamentous phages antibody was raised in mouse using fd phages from E.Coli F+ strain as the immunogen.</p>

<p>Rabbit polyclonal BRCA1 antibody (Ser1457)</p>

<p>Rabbit polyclonal PPIA antibody (biotin)</p>

<p>The MEF2C antibody is a highly specific monoclonal antibody that targets the MEF2C protein. This protein plays a crucial role in various biological processes, including cholinergic signaling, adeno-associated virus formation inhibition, and growth factor regulation. By binding to MEF2C, this antibody can modulate its activity and potentially impact the function of downstream pathways.</p>

<p>LIPH antibody was raised in Rabbit using Human LIPH as the immunogen</p>

<p>The DUSP6 antibody is a highly specific monoclonal antibody that targets the dual specificity phosphatase 6 (DUSP6) protein. This antibody has been extensively tested and validated for use in various research applications, particularly in the field of Life Sciences.</p>

<p>Affinity purified Rabbit polyclonal IFIT3 antibody</p>

<p>Rabbit polyclonal TRF1 antibody (Ser219)</p>

<p>KLHDC8B antibody was raised using the middle region of KLHDC8B corresponding to a region with amino acids AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM</p>

<p>Mouse monoclonal Carcinoma Associated Antigen antibody</p>

<p>EPHA5 antibody was raised in Mouse using a purified recombinant fragment of EPHA5(aa620-774) expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal COX17 antibody</p>

<p>ANKRD2 antibody was raised in Rabbit using Human ANKRD2 as the immunogen</p>

<p>The Lp-PLA2 monoclonal antibody is a highly specialized and targeted therapeutic agent. It is a monoclonal antibody that specifically binds to lipoprotein-associated phospholipase A2 (Lp-PLA2), an enzyme involved in the formation of atherosclerotic plaques. This antibody has been extensively studied and has shown promising results in reducing cardiovascular events.</p>

<p>Mouse monoclonal NME4 antibody</p>

<p>CCDC93 antibody was raised in Rabbit using Human CCDC93 as the immunogen</p>

<p>Rabbit polyclonal LAMA2 antibody</p>

<p>Rabbit Polyclonal Ckit antibody (Tyr936)</p>

<p>Symplekin antibody was raised in mouse using human symplekin as the immunogen.</p>

<p>Rabbit polyclonal RPL17 antibody</p>

<p>RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG</p>

<p>The CD40 antibody is a potent cytotoxic agent that targets pancreatic elastase and collagen. It has been shown to inhibit the activity of transforming growth factor-beta (TGF-beta) in human hepatocytes, which plays a crucial role in liver fibrosis. The CD40 antibody also binds to calmodulin, inhibiting the activity of elastase and preventing tissue damage. This monoclonal antibody has been used as a medicament in various therapeutic applications, including the treatment of autoimmune diseases and cancer. Additionally, it has natriuretic properties and can regulate the levels of growth factors in the body. With its wide range of effects, the CD40 antibody is a valuable tool for researchers and clinicians alike.</p>

<p>HOXB7 antibody was raised in mouse using recombinant Human Homeo Box B7</p>

<p>The CDK8 antibody is a polyclonal antibody that targets CDK8, a protein involved in various cellular processes. It has been shown to interact with β-catenin and mitogen-activated protein kinases, regulating their activity. This antibody can be used in life sciences research to study the role of CDK8 in cell signaling pathways and transcriptional regulation. Additionally, it has been used for immunohistochemistry and Western blotting to detect CDK8 expression in different tissues and cell lines. The CDK8 antibody is highly specific and does not cross-react with other proteins, ensuring accurate results. It is a valuable tool for researchers studying the function of CDK8 and its involvement in disease processes.</p>

<p>FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV</p>

<p>BMP7 antibody was raised in mouse using recombinant human BMP7 (293-431aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal PGDH3 antibody</p>

<p>Mouse monoclonal EXD1 antibody</p>

<p>Rabbit polyclonal SEC13 antibody</p>

<p>ASB9 antibody was raised in Rabbit using Human ASB9 as the immunogen</p>

<p>The CD70 antibody is a highly specialized product in the field of Life Sciences. It acts as a growth factor and plays a crucial role in microvessel density regulation. This antibody specifically targets alpha-synuclein, an antigen associated with neurodegenerative disorders.</p>

<p>The RGMB antibody is a highly potent monoclonal antibody that exhibits cytotoxic effects. It has been extensively studied and has shown promising results in various fields of Life Sciences. This antibody specifically targets RGMB, a protein involved in endothelial growth and development. By neutralizing RGMB, this antibody inhibits the signaling pathways associated with angiogenesis, making it a valuable tool for researchers studying vascular biology and related diseases.</p>

<p>The SOCS1 antibody is a powerful tool used in the field of Life Sciences for various research purposes. It is a Polyclonal Antibody that specifically targets the Suppressor of Cytokine Signaling 1 (SOCS1) protein. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Purified Rabbit polyclonal FOX pan antibody (Thr24/32)</p>

<p>The Recoverin antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the protein recoverin, which plays a crucial role in vision and photoreceptor cell function. This antibody can be used to detect and quantify recoverin levels in various biological samples.</p>

<p>GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ</p>

<p>Rabbit polyclonal AP2M1 antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal Connexin 40 antibody</p>

<p>HEL308 antibody was raised in mouse using recombinant Human Dna Helicase Hel308</p>

<p>RAB14 antibody was raised in rabbit using the C terminal of RAB14 as the immunogen</p>

<p>Mouse monoclonal PSMB7 antibody</p>

<p>The RL10 antibody is a highly effective antibiotic that is widely used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and has been specifically designed to target triglyceride lipase, a key enzyme involved in lipid metabolism. This antibody exhibits potent neutralizing activity against triglyceride lipase, making it an invaluable tool for researchers studying adipose tissue and lipoprotein metabolism.</p>