Primary Antibodies

<p>Rabbit polyclonal Mt13 antibody</p>

<p>GTPBP3 antibody was raised in Rabbit using Human GTPBP3 as the immunogen</p>

<p>BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.</p>

<p>BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK</p>

<p>Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.</p>

<p>Rabbit polyclonal PSG4 antibody</p>

<p>AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF</p>

<p>Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP</p>

<p>LYZL6 antibody was raised in Rabbit using Human LYZL6 as the immunogen</p>

<p>GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV</p>

<p>MPG antibody was raised in Rabbit using Human MPG as the immunogen</p>

<p>The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.</p>

<p>MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen</p>

<p>Rabbit polyclonal RND2 antibody</p>

<p>The AKR1C3 antibody is a reactive antibody used in Life Sciences research. It can be used as both a polyclonal and monoclonal antibody. This antibody is commonly used to detect autoantibodies in human serum samples. It specifically targets AKR1C3, an enzyme that plays a role in hormone metabolism and has been implicated in various diseases, including cancer.</p>

<p>Mouse monoclonal QPRT antibody</p>

<p>Mouse monoclonal DNAAF1 antibody</p>

<p>Goat polyclonal Human Serum Albumin antibody (FITC) conjugated</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>GALK1 antibody was raised in rabbit using the C terminal of GALK1 as the immunogen</p>

<p>The EDD antibody is a monoclonal antibody that has neutralizing properties. It is specifically designed to target and bind to glycan molecules, thereby inhibiting the activity of TNF-α (tumor necrosis factor-alpha) and erythropoietin. This antibody is commonly used in ophthalmic formulations and in Life Sciences research for the detection and analysis of biomolecules. Additionally, the EDD antibody can be utilized in various assays to measure enzyme activity, such as phosphatase or lipoprotein lipase. Its high specificity and affinity make it an excellent tool for studying chemokines and other related proteins. For researchers looking for a reliable antibody with diverse applications, the EDD antibody is an ideal choice.</p>

<p>Rabbit polyclonal PCDHA6 antibody</p>

<p>Rat PMN antibody (FITC) was raised in rabbit using rat PMNs as the immunogen.</p>

<p>The ARSA antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to arylsulfatase A (ARSA), an enzyme involved in the breakdown of sulfatides. By binding to ARSA, this antibody inhibits its activity, leading to a decrease in the breakdown of sulfatides.</p>

<p>The RyR2 antibody is a polyclonal antibody that specifically targets the ryanodine receptor 2 (RyR2) protein. This antibody is widely used in life sciences research to study the role of RyR2 in various cellular processes. The RyR2 protein plays a crucial role in calcium release from the sarcoplasmic reticulum, which is essential for muscle contraction and relaxation. This antibody can be used for immunohistochemistry, western blotting, and other techniques to detect and quantify RyR2 expression levels in different tissues and cell types. It has been shown to have high specificity and sensitivity, making it a reliable tool for researchers studying calcium signaling, cardiac physiology, and other related fields. With its ability to bind to the target protein with high affinity, this antibody provides valuable insights into the regulation and function of RyR2 in both normal and pathological conditions.</p>

<p>The RSAD2 antibody is a highly sensitive monoclonal antibody that is used for ultrasensitive detection of the growth factor. It specifically targets the RSAD2 molecule, making it an essential tool in Life Sciences research. This monoclonal antibody can be immobilized on an electrode surface for reactive and activated detection of the RSAD2 molecule. It has also been shown to have high affinity for other molecules such as erythropoietin receptor and collagen. In addition to its application in research, this antibody can be used for the detection of autoantibodies or as part of diagnostic tests in medical settings. Whether you need to study molecular interactions or develop diagnostic assays, the RSAD2 antibody is a valuable tool that delivers accurate and reliable results.</p>

<p>The FGFR2 antibody is a specific monoclonal antibody that targets the fibroblast growth factor receptor 2 (FGFR2). It has been extensively studied in the field of life sciences and has shown promising results in various applications. This antibody is highly specific and binds to non-phosphorylated FGFR2, inhibiting its activity.</p>

<p>Purified Polyclonal B4GALT5 antibody</p>

<p>The LANCL1 antibody is a basic protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research to study the function and interactions of LANCL1. This antibody has shown promising results in studies involving collagen synthesis and its regulation. Additionally, it has been used in experiments investigating the effects of imatinib on LANCL1 activity. The LANCL1 antibody is known for its high specificity and sensitivity, making it an excellent tool for detecting LANCL1 levels in samples. Researchers have also utilized this antibody to detect autoantibodies, such as antiphospholipid antibodies, and explore their potential implications in disease development. Furthermore, this polyclonal antibody has been employed to examine the role of LANCL1 in steroid and glucagon signaling pathways. Overall, the LANCL1 antibody offers valuable insights into the functions and mechanisms associated with this protein, making it an essential tool for researchers in various fields of study.</p>

<p>The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.</p>

<p>AMY2A antibody was raised in Rabbit using Human AMY2A as the immunogen</p>

<p>Rabbit polyclonal Keratin 16 antibody</p>

<p>FGF5 antibody was raised in mouse using highly pure recombinant human FGF-5 as the immunogen.</p>

<p>The OGT antibody is a highly specialized antibody that targets the necrosis factor-related apoptosis-inducing protein complex. It is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications in Life Sciences research. This antibody is particularly useful for studying the regulation of alpha-fetoprotein, as well as the neutralizing effects on growth factors and nuclear steroid binding proteins. The OGT antibody is designed to specifically bind to its target in human serum, allowing for accurate and reliable results in various experiments. With its exceptional specificity and high affinity, this antibody is an essential tool for researchers working in the field of protein complex analysis.</p>

<p>The LKB1 antibody is a monoclonal antibody that specifically targets the molecule known as mesothelin. It has been extensively tested in various studies and has shown high affinity for binding to human serum and collagen. This antibody is widely used in Life Sciences research for its ability to detect and analyze the expression of mesothelin in different samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, leading to the inhibition of bacterial growth. Through extensive research using a patch-clamp technique on human erythrocytes, it has been proven to have high efficacy in humans.</p>

<p>Mouse monoclonal BTCL2 antibody</p>

<p>DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG</p>

<p>Rabbit polyclonal BLK antibody (Tyr501)</p>

<p>Purified Rabbit polyclonal B4GALT5 antibody</p>

<p>The PAPPA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein known as Pregnancy-associated plasma protein A (PAPPA). PAPPA is an important biomarker that plays a crucial role in various biological processes, including epidermal growth factor regulation and cytotoxic activity.</p>

<p>ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Mouse monoclonal Hepatitis C Virus antibody (core)</p>

<p>Rabbit polyclonal NPL antibody</p>

<p>Mouse monoclonal Reticulon 1A/B antibody</p>

<p>Purified Polyclonal BMP3 antibody</p>

<p>Rabbit polyclonal DNA Ligase 4 antibody</p>

<p>The SPARC antibody is a highly reactive and neutralizing monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the SPARC protein, which plays a crucial role in various cellular processes such as cell adhesion, migration, and proliferation. This antibody can be used for intraocular applications, as well as in vitro experiments involving chemokine signaling pathways, fatty acid metabolism, fibroin synthesis, and telomerase activity. Additionally, the SPARC antibody has been shown to have potential therapeutic applications in regenerative medicine due to its ability to interact with mesenchymal stem cells and modulate their behavior. Whether you need a recombinant antigen or polyclonal antibodies for your research, the SPARC antibody is an essential tool that can provide valuable insights into cellular mechanisms and contribute to advancements in the field of Life Sciences.</p>

<p>Rabbit polyclonal OXCT2 antibody</p>

<p>The GTPBP2 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets GTPBP2, a protein involved in various cellular processes. This antibody can be used to detect the presence of GTPBP2 in samples and study its functions.</p>

<p>EMILIN1 antibody was raised in Rabbit using Human EMILIN1 as the immunogen</p>

<p>EIF3F antibody was raised in rabbit using the C terminal of EIF3F as the immunogen</p>

<p>The S100A3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the S100A3 protein, which is associated with epidermal growth factor and cholinergic signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The S100A3 antibody is known to bind to the S100A3 protein with high affinity, making it an essential tool for studying the role of this protein in cellular processes. Whether you are investigating the effects of androgens on choline acetyltransferase activity or examining the expression of S100A3 in human serum samples, this antibody will provide reliable results. Choose the S100A3 antibody for your research needs and unlock new insights into the intricate mechanisms of cellular function.</p>

<p>Rabbit polyclonal Csk antibody (Ser364)</p>

<p>MUS81 antibody was raised in Rabbit using Human MUS81 as the immunogen</p>

<p>CD8 antibody was raised in mouse using human CD8 as the immunogen.</p>

<p>Rabbit Polyclonal PJA2 antibody</p>

<p>Mouse monoclonal CD32 antibody (allophycocyanin)</p>

<p>ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG</p>

<p>BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids PLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDG</p>

<p>The CD29 antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of Life Sciences. It is particularly useful for detecting autoantibodies and alpha-fetoprotein, as well as for studying the function of various proteins and glycopeptides. The CD29 antibody can also be used to investigate the role of arginase and leukemia inhibitory factor in different biological processes.</p>

<p>The SATB1 antibody is a highly specialized growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has cytotoxic and antiangiogenic properties, making it an effective proliferation inhibitor. In the field of Life Sciences, this antibody is widely used for its ability to neutralize various growth factors, including epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), and chemokines. The SATB1 antibody specifically targets low-molecular-weight endothelial growth factors, inhibiting their activity and preventing angiogenesis. This monoclonal antibody is a valuable tool in research and clinical applications related to cancer, inflammation, and other diseases involving abnormal cell growth.</p>

<p>ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PCDHGC3 antibody</p>

<p>Rabbit polyclonal GluR2/3 antibody</p>

<p>Mouse monoclonal SLT1 antibody</p>

<p>Rabbit polyclonal VPS16 antibody</p>

<p>SSBP1 antibody was raised in rabbit using the N terminal of SSBP1 as the immunogen</p>

<p>Donkey anti-rat IgG (H + L) (FITC) was raised in donkey using Rat IgG (H&amp;L) as the immunogen.</p>

<p>The HER2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the epidermal growth factor receptor 2 (HER2). This receptor plays a crucial role in cell growth and division, and its overexpression has been linked to various types of cancer, including breast cancer.</p>

<p>IKBKB antibody was raised in Rabbit using Human IKBKB as the immunogen</p>

<p>Rabbit polyclonal JMY antibody</p>

<p>APLN antibody was raised in Rabbit using Human APLN as the immunogen</p>

<p>The CD1A antibody is a histidine-rich, cytotoxic monoclonal antibody that targets the CD1A protein. This protein is involved in various cellular processes, including growth factor and chemokine signaling. The CD1A antibody has been extensively used in life sciences research, particularly in immunoassays and transfer reactions. It can be used for the detection and quantification of CD1A in various biological samples.</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.</p>

<p>Affinity purified Rabbit polyclonal OSBPL6 antibody</p>

<p>PLA2G4E antibody was raised using the C terminal of PLA2G4E corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT</p>

<p>MATK antibody was raised in Mouse using a purified recombinant fragment of human MATK expressed in E. coli as the immunogen.</p>

<p>The NuMA antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the NuMA protein, which plays a crucial role in cell division and organization of the mitotic spindle. By binding to NuMA, this antibody can effectively neutralize its function and inhibit cell growth and division.</p>

<p>Rabbit polyclonal TRMT1 antibody</p>

<p>The APP antibody is a monoclonal antibody that targets amyloid precursor protein (APP). It is widely used in Life Sciences research to study the role of APP in various cellular processes. This antibody specifically detects the superoxide produced by APP metabolism, allowing researchers to investigate its involvement in oxidative stress-related diseases. Additionally, the APP antibody can be used to assess e-cadherin expression and monitor changes in cell adhesion. Its high specificity and sensitivity make it an essential tool for studying the function of APP and its potential as a therapeutic target. Researchers can also use this antibody to explore the impact of interferon-gamma on APP metabolism and investigate its interactions with other proteins such as tropomyosin. With its wide range of applications, the APP antibody is a valuable resource for scientists working in diverse fields such as neuroscience, immunology, and molecular biology.</p>

<p>RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN</p>

<p>C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED</p>

<p>Rabbit polyclonal SRF antibody (Ser99)</p>

<p>Rabbit polyclonal OR2T2 antibody</p>

<p>The FGF21 antibody is a monoclonal antibody that belongs to the category of antibodies used in Life Sciences. It targets and inhibits the activity of fibroblast growth factor 21 (FGF21), which is a growth factor involved in various biological processes. This antibody has been shown to have an impact on lipoprotein lipase activity, phosphatase activity, and the expression of apolipoprotein A-I (apoA-I). By targeting FGF21, this antibody can modulate lipid metabolism and potentially have therapeutic effects on conditions such as obesity and metabolic disorders. Additionally, it may interact with tyrosine kinase receptors and globulins to regulate signaling pathways related to growth hormone receptors. The FGF21 antibody represents a promising tool for research and development in the field of molecular biology and therapeutics.</p>

<p>CPN1 antibody was raised in Rabbit using Human CPN1 as the immunogen</p>

<p>Rat monoclonal CD62L antibody (FITC)</p>

<p>Rabbit polyclonal STAU1 antibody</p>

<p>Rabbit polyclonal GSTP1 antibody (FITC)</p>

<p>Rabbit polyclonal PUB12 antibody</p>

<p>Affinity purified Rabbit polyclonal TTC11 antibody</p>

<p>Rabbit polyclonal TCEB1 antibody</p>

<p>Rabbit polyclonal EGFR antibody (Ser1071)</p>

<p>The PTGFRN antibody is a highly specialized polyclonal antibody that targets the PTGFRN protein. This protein is involved in various cellular processes, including signal transduction and gene expression regulation. The PTGFRN antibody specifically recognizes and binds to the p38 mitogen-activated protein (MAP) kinase and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathways.</p>

<p>The HDAC2 antibody is a highly specific and potent cytotoxic agent that targets HDAC2, an enzyme involved in gene regulation. This antibody has been extensively studied in various research fields, including Life Sciences and drug development.</p>

<p>Rabbit polyclonal PPP1R1B antibody</p>

<p>Purified Polyclonal RFX3 antibody</p>

<p>Rabbit polyclonal RPS21 antibody</p>