Primary Antibodies

<p>Rabbit polyclonal Alpha endosulfine antibody (HRP)</p>

<p>P2RX7 antibody was raised using the middle region of P2RX7 corresponding to a region with amino acids VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP</p>

<p>Rabbit polyclonal P2RY6 antibody</p>

<p>BMP2 antibody was raised in rabbit using highly pure recombinant human BMP-2 as the immunogen.</p>

<p>C12ORF50 antibody was raised using the N terminal Of C12Orf50 corresponding to a region with amino acids INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT</p>

<p>PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV</p>

<p>Rabbit polyclonal ELAVL2 antibody</p>

<p>HSPA1L antibody was raised using the C terminal of HSPA1L corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD</p>

<p>CD4 antibody was raised in mouse using chicken CD4 as the immunogen</p>

<p>HER2 antibody was raised in Mouse using a purified recombinant fragment of HER-2 expressed in E. coli as the immunogen.</p>

<p>Clostridium difficile toxin B antibody is an antiphospholipid antibody that has the ability to neutralize toxins produced by Clostridium difficile. It is a monoclonal antibody that specifically targets toxin B, which is responsible for the pathogenic effects of C. difficile infection. This antibody works by binding to the toxin and preventing its interaction with host cells, thereby reducing the severity of the infection. Additionally, this antibody has been shown to have anti-connexin properties and can inhibit the activation of fibrinogen and glycoprotein receptors. It is widely used in life sciences research and diagnostic applications for studying C. difficile infection and related diseases.</p>

<p>CCR5 antibody was raised in Rabbit using Human CCR5 as the immunogen</p>

<p>Rabbit polyclonal PLA2G2A antibody (FITC)</p>

<p>AAAS antibody was raised in Rabbit using Human AAAS as the immunogen</p>

<p>SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, as it contains active compounds with bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high frequency of human activity through patch-clamp techniques on human erythrocytes. Additionally, the drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ZAP70 antibody was raised in Mouse using a purified recombinant fragment of human ZAP70 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal ATRIP antibody (Ser224)</p>

<p>PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE</p>

<p>Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL</p>

<p>FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen</p>

<p>ARFGAP3 antibody was raised in Rabbit using Human ARFGAP3 as the immunogen</p>

<p>ACT antibody was raised in rabbit using N terminus of ACT as the immunogen.</p>

<p>GOT2 antibody was raised in Mouse using a purified recombinant fragment of human GOT2 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal POLR2D antibody</p>

<p>FAF1 antibody was raised in Rabbit using Human FAF1 as the immunogen</p>

<p>LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ</p>

<p>The BRCA1 antibody is a highly specialized monoclonal antibody that specifically targets the BRCA1 protein. This protein plays a crucial role in DNA repair and is associated with the development of breast and ovarian cancers. The BRCA1 antibody has been extensively studied and has shown cytotoxic effects on cancer cells by inhibiting the activity of protein kinases involved in cell proliferation. It binds to the nuclear compartment of cells, specifically targeting the BRCA1 protein, which leads to its degradation and prevents its function in repairing damaged DNA. This antibody has also been used in research to study other proteins, such as alpha-synuclein and collagen, and has shown potential as a therapeutic agent for various types of cancer. With its high specificity and ability to inhibit activated proteins, the BRCA1 antibody is a valuable tool for both diagnostic purposes and targeted therapies.</p>

<p>Rabbit polyclonal ARRDC3 antibody</p>

<p>Rabbit polyclonal CHRM5 antibody</p>

<p>Rabbit polyclonal Elk1 antibody (Ser383)</p>

<p>Rabbit polyclonal MAPKAPK2 antibody</p>

<p>Rabbit polyclonal STEAP1 antibody (FITC)</p>

<p>RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI</p>

<p>IL1 beta antibody is a highly effective and versatile antibody that targets the IL1 beta protein, a key player in the immune response and inflammation. This monoclonal antibody specifically binds to IL1 beta, neutralizing its activity and preventing its interaction with its receptor. By inhibiting IL1 beta, this antibody can effectively reduce inflammation and promote healing.</p>

<p>IL10 antibody was raised in Mouse using a purified recombinant fragment of human IL-10 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal CHSY2 antibody</p>

<p>Actin antibody was raised in mouse using synthetic NH2 terminus decapeptide of cardiac isoform of actin as the immunogen.</p>

<p>CD31 antibody was raised in Mouse using a purified recombinant fragment of human CD31 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal SPFH2 antibody</p>

<p>TCHP antibody was raised in rabbit using the C terminal of TCHP as the immunogen</p>

<p>TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR</p>

<p>CRTC1 antibody was raised in Rabbit using Human CRTC1 as the immunogen</p>

<p>PDS5A antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEA</p>

<p>LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL</p>

<p>CHST9 antibody was raised in Rabbit using Human CHST9 as the immunogen</p>

<p>Rabbit polyclonal Aldolase antibody (biotin)</p>

<p>Rabbit polyclonal PAK5/6 antibody (Ser602/Ser560)</p>

<p>Rabbit polyclonal PKC mu antibody (Ser738+Ser742)</p>

<p>NFE2L1 antibody was raised in Rabbit using Human NFE2L1 as the immunogen</p>

<p>Purified Polyclonal TGF beta 3 antibody</p>

<p>CD18 antibody (Azide free) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>

<p>The PIAS2 antibody is a serum marker protein that is used in the field of Life Sciences. It belongs to the class of Antibodies and is specifically designed to detect and bind to PIAS2, a protein involved in various cellular processes. This polyclonal antibody is highly specific and can be used for research purposes as well as therapeutically. With its ability to target PIAS2, this antibody provides valuable insights into the functioning of cells and can aid in the development of novel treatments and therapies. Whether you are conducting experiments or looking for potential therapeutic options, the PIAS2 antibody is an essential tool in your arsenal.</p>

<p>Rabbit polyclonal MPZ antibody (FITC)</p>

<p>EDN3 antibody was raised in Rabbit using Human EDN3 as the immunogen</p>

<p>The BID antibody is a polyclonal antibody that is capable of neutralizing the antigen. It specifically targets membrane-spanning polypeptides, forming dimers and effectively neutralizing their activity. This synthetic antibody has been extensively tested and shown to effectively bind to activated amyloid plaque, making it a valuable tool in life sciences research. The BID antibody is commonly used in buffered assays and can also be used in combination with other monoclonal antibodies for enhanced specificity and sensitivity. Its high-quality formulation ensures reliable and reproducible results in various experimental applications.</p>

<p>Rabbit polyclonal RPS10 antibody (FITC)</p>

<p>Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.</p>

<p>Rabbit polyclonal PMFBP1 antibody</p>

<p>Borrelia burgdorferi antibody (HRP) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL</p>

<p>IL1A antibody is a monoclonal antibody that specifically targets interleukin-1 alpha (IL-1α), a cytokine involved in various inflammatory processes. IL-1α plays a crucial role in the regulation of immune responses and is associated with several diseases, including autoimmune disorders and cancer. This antibody binds to IL-1α, preventing its interaction with its receptors and blocking downstream signaling pathways. It has been shown to inhibit the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, IL1A antibody has demonstrated efficacy in multidrug-resistant cancer cell lines, suggesting its potential as a therapeutic agent. Its high affinity for IL-1α ensures effective neutralization of this cytokine, making it an essential tool for researchers in the field of life sciences.</p>

<p>BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal p53 antibody (Ser33)</p>

<p>Rabbit polyclonal HNRPH1 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. This active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>GAMT antibody was raised in Rabbit using Human GAMT as the immunogen</p>

<p>PHYHIPL antibody was raised in rabbit using the C terminal of PHYHIPL as the immunogen</p>

<p>Purified Polyclonal Apolipoprotein L6 antibody</p>

<p>HCCS antibody was raised in rabbit using the C terminal of HCCS as the immunogen</p>

<p>CNTN4 antibody was raised in Rabbit using Human CNTN4 as the immunogen</p>

<p>CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA</p>

<p>Purified Rabbit polyclonal Tip60 antibody (Ser90)</p>

<p>Purified Polyclonal FASTKD2 antibody</p>

<p>NHLH1 antibody was raised in rabbit using the middle region of NHLH1 as the immunogen</p>

<p>FABP3 antibody was raised in Rabbit using Human FABP3 as the immunogen</p>

<p>The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.</p>

<p>Ankyrin antibody was raised in mouse using purified human erythroid cells ankyrin as the immunogen.</p>

<p>HIV1 gp120 antibody (HRP) was raised in goat using purified native gp120 from strain IIIB as the immunogen.</p>

<p>GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF</p>

<p>MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA</p>

<p>ZNF71 antibody was raised in rabbit using the middle region of ZNF71 as the immunogen</p>

<p>RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE</p>

<p>Purified Polyclonal UBE4A antibody</p>

<p>The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.</p>

<p>CD3e antibody was raised in hamster using CD3e as the immunogen.#</p>

<p>RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ</p>

<p>CHAD antibody was raised in Rabbit using Human CHAD as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody</p>

<p>ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT</p>

<p>Rabbit polyclonal ASAH3L antibody</p>

<p>HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD</p>

<p>Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME</p>

<p>The RELT antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that has been specifically developed to target and neutralize the activity of hepcidin, a growth factor involved in various physiological processes. This antibody has been extensively tested and proven to effectively inhibit hepcidin-induced syncytia formation.</p>

<p>The FZD5 antibody is a monoclonal antibody that targets the frizzled-5 receptor, a member of the frizzled family of proteins. This receptor plays a crucial role in the Wnt signaling pathway, which is involved in various cellular processes such as cell proliferation, differentiation, and migration. The FZD5 antibody specifically binds to the activated form of the frizzled-5 receptor, blocking its interaction with Wnt ligands and preventing downstream signaling events.</p>

<p>NFYA antibody was raised in Rabbit using Human NFYA as the immunogen</p>

<p>Purified Polyclonal NCAPH antibody</p>

<p>Purified Polyclonal TCP1 theta antibody</p>

<p>ALDH4A1 antibody was raised in Rabbit using Human ALDH4A1 as the immunogen</p>

<p>IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG</p>