Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
CDK4 antibody
The CDK4 antibody is a cytotoxic monoclonal antibody that targets the cyclin-dependent kinase 4 (CDK4) protein. It is used in the field of Life Sciences for various applications, including research and diagnostics. The CDK4 antibody specifically binds to CDK4 and inhibits its activity, which plays a crucial role in cell cycle regulation. This inhibition can lead to cell cycle arrest and apoptosis in cancer cells that rely on CDK4 for uncontrolled growth. Additionally, the CDK4 antibody has been shown to modulate other signaling pathways, such as the E-cadherin/β-catenin pathway, which is involved in cell adhesion and migration. This antibody can be used in combination with other antibodies or drugs to enhance its efficacy against specific targets or diseases. Its potential applications extend beyond cancer treatment, as it has also shown antiviral activity against certain viruses and interferon-inducing properties. Researchers and scientists rely on the CDK4 antibody to
Carboxypeptidase E antibody
Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Purity:Min. 95%COL1A2 antibody
The COL1A2 antibody is a powerful tool in Life Sciences research. This antibody has inhibitory properties and can be used in various applications such as insulin immunoassays and the study of liver microsomes. It belongs to the class of Polyclonal Antibodies, which are highly specific and versatile. The COL1A2 antibody can be used to detect and quantify interferon, TGF-β1, and other autoantibodies in samples. It specifically targets nuclear tyrosine residues that are activated during cellular processes. Researchers rely on this monoclonal antibody for its exceptional sensitivity and reliability in their experiments.
IKB alpha antibody
The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.
Purity:Min. 95%DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
Calretinin antibody
The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.
SCD antibody
SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
Clostridium difficile toxin B antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Experience effective treatment for tuberculosis infection with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside. This antituberculosis drug, belonging to the rifamycins class, offers bactericidal activity against Mycobacterium strains. By inhibiting DNA-dependent RNA polymerase, it prevents transcription and replication, effectively inhibiting bacterial growth. With its high frequency of human activity and metabolic transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, this active compound ensures optimal results. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment of tuberculosis infections.Annexin A4 antibody
Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Antithrombin III antibody
Antithrombin III antibody was raised in goat using human antithrombin purified from plasma as the immunogen.Purity:Min. 95%CHRNE antibody
CHRNE antibody was raised in rabbit using the N terminal of CHRNE as the immunogen
Purity:Min. 95%HDAC4 antibody
The HDAC4 antibody is a highly specific antibody that targets the histone deacetylase 4 (HDAC4) protein. HDAC4 is involved in the regulation of gene expression and plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody can be used for research purposes in the field of Life Sciences to study the function and localization of HDAC4 in different cell types.
Purity:Min. 95%FAF1 antibody
FAF1 antibody is a monoclonal antibody that specifically targets Fas-associated factor 1 (FAF1), a protein found in the nucleus. This antibody has been extensively studied in Life Sciences research and has shown promising results in various assays. It has been shown to effectively bind to and immobilize FAF1, leading to the inhibition of its phosphatase activity. This makes FAF1 antibody a valuable tool for studying the role of FAF1 in cellular processes and signaling pathways.
Nurr1 antibody
Nurr1 antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Nurr1 protein as the immunogen.
Purity:Min. 95%OR51E2 antibody
The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.
PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
CD71 antibody (Azide Free)
CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.
PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%IL13 antibody
IL13 antibody was raised in rabbit using highly pure recombinant human IL-13 as the immunogen.Purity:Min. 95%PRKAA2 antibody
PRKAA2 antibody was raised using the middle region of PRKAA2 corresponding to a region with amino acids AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
MYPN antibody
The MYPN antibody is a retinoid that belongs to the class of antibodies. It specifically targets 6-phosphogluconate dehydrogenase and has antinociceptive properties. This monoclonal antibody is widely used in the field of Life Sciences and has been shown to inhibit methyl transferase activity. The MYPN antibody also plays a crucial role in collagen synthesis and can be used as an inhibitor for HDAC (histone deacetylase) enzymes. It is commonly used in the development of medicines and vaccines, particularly against nuclear-related diseases. Additionally, this polyclonal antibody has been shown to enhance acetylation processes and is effective against vaccine strains.
PVRL2 antibody
The PVRL2 antibody is a highly specialized antibody that targets the PVRL2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, immune response, and signal transduction. The PVRL2 antibody has been extensively studied and proven to be effective in research applications related to echinococcus, tyrosine kinase-like activity, phosphatase activity, arginase activity, actin filament organization, and circumsporozoite protein interactions.
GPT Antibody
The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.Purity:Min. 95%Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.VSV-G antibody
VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.
Purity:Min. 95%IARS2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.
HIV1 p24 antibody (HRP)
HIV1 p24 antibody (HRP) was raised in goat using purified native p24 from strain IIIB as the immunogen.CK1 delta antibody
CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
COX4 antibody
The COX4 antibody is a highly specialized antibody that targets the COX4 protein. This protein plays a crucial role in various biological processes, including energy production and cellular respiration. The COX4 antibody is widely used in life sciences research to study the function and regulation of this important protein.
Fibronectin antibody
The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.
MAP2 antibody
The MAP2 antibody is a growth factor antagonist that binds to specific proteins in order to inhibit their activity. It is a monoclonal antibody, meaning it is produced from a single clone of cells and is highly specific in its binding properties. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
Purity:Min. 95%GLUD1 antibody
GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%DCI antibody
The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.
GNAS antibody
GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
FAM53C antibody
FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG
Factor X antibody
Factor X antibody was raised in sheep using purified mouse factor X as the immunogen.Purity:Min. 95%ApoH antibody
ApoH antibody was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.
Mouse PMN antibody (FITC)
Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.
PDZK1 antibody
The PDZK1 antibody is a highly specialized molecule drug that falls under the category of antibodies in the Life Sciences field. It is designed to target a specific molecule known as PDZK1. This antibody can be used for various applications, including research and diagnostic purposes.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
