Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
PODXL antibody
PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
HSP60 antibody
The HSP60 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the acyl-CoA-binding protein (ACBP) and can be used in various immunoassays to detect and measure the levels of ACBP in different samples. ACBP is a glycoprotein that plays a crucial role in fatty acid metabolism and transport within cells. The HSP60 antibody can be used to study the expression and localization of ACBP in different cell types, including human endothelial cells and adipose tissue. It can also be used to investigate the interaction between ACBP and other proteins, such as growth factors, in order to better understand their roles in cellular processes. The HSP60 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it an invaluable tool for studying the functions of ACBP in cellular biology.
NCS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that belongs to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This powerful drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
Tau antibody
The Tau antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and neutralize the effects of tau proteins. Tau proteins are known for their involvement in various neurodegenerative diseases, such as Alzheimer's disease.
VSIG4 antibody
VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
CtBP1 antibody
The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.
IL24 antibody
The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.
Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
MCM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
ROR1 antibody
ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.TGF beta 1 antibody
TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.
CKMB Antibody
The CKMB Antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to the CKMB protein, which is an important biomarker for various cardiac conditions.Rad54 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
GRB2 antibody
The GRB2 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It has been developed to target and bind specifically to the GRB2 protein, which plays a crucial role in cell signaling pathways. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Caspase 8 antibody
The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody that targets the thyroid peroxidase enzyme. This enzyme plays a crucial role in the synthesis of thyroid hormones. By binding to the enzyme, Thyroid Peroxidase antibody inhibits its activity, leading to a decrease in thyroid hormone production. This antibody has been extensively used in research and diagnostic applications in the field of Life Sciences. It has shown great potential for studying cholinergic signaling pathways, genotoxic effects, fatty acid metabolism, and neutralizing specific proteins such as collagen and acetylcholine. With its high specificity and affinity, Thyroid Peroxidase antibody is an essential tool for researchers working in various areas of biology and medicine.MTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
COL1A1 antibody
The COL1A1 antibody is a polyclonal antibody that specifically targets collagen type I alpha 1 chain. It can be used in various research applications, including immunohistochemistry and western blotting. This antibody plays a crucial role in the study of lipoprotein lipase and its interaction with collagen. Additionally, it has been shown to have potential therapeutic applications in diseases such as trastuzumab-resistant breast cancer.
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
RBM5 antibody
The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.
ApoA1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Additionally, it has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA
Connexin 43 antibody
The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.
GABRB2 antibody
GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR
CCR10 antibody
The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.
MCM5 antibody
The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.
GST antibody
The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.
Triiodothyronine antibody
Triiodothyronine antibody is a monoclonal antibody that specifically targets and inhibits the activity of tyrosine kinase receptors. It is commonly used in life sciences research to study the role of these receptors in various cellular processes. Triiodothyronine antibody has been shown to effectively neutralize the growth factor signaling pathway by blocking the interaction between growth factors and their receptors. This inhibition leads to a decrease in cell proliferation and survival. Additionally, this antibody can be used in cytotoxic assays to assess the efficacy of tyrosine kinase inhibitors, such as imatinib. The binding of triiodothyronine antibody to its target receptor also results in dephosphorylation events mediated by phosphatases, which further modulate cellular responses. Its specificity and ability to inhibit tyrosine kinase activity make triiodothyronine antibody a valuable tool for studying signal transduction pathways and developing targeted therapies against diseases driven by aberrant receptor activation.Interferon gamma antibody
The Interferon gamma antibody is a monoclonal antibody that targets interferon gamma, a growth factor involved in immune response regulation. This antibody is widely used in Life Sciences research to study the functions and effects of interferon gamma. It can be used for various applications such as immunohistochemistry, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). The Interferon gamma antibody specifically binds to interferon gamma and can be used to detect its presence in biological samples. It has high specificity and sensitivity, making it an essential tool for researchers studying the role of interferon gamma in various biological processes.
HIPK2 antibody
The HIPK2 antibody is a highly specialized tool used in Life Sciences research. It is a Polyclonal Antibody that is designed for the ultrasensitive detection and neutralization of clostridial neurotoxins. The antibody can be immobilized on a carbon electrode, allowing for electrochemical impedance spectroscopy to be performed. This technique enables researchers to accurately measure the presence and activity of the toxins in various samples.
DKK3 antibody
The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
NR2F2 antibody
NR2F2 antibody was raised in rabbit using the N terminal of NR2F2 as the immunogenPurity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
