Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
TLR8 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied and shown to be highly effective using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Chondroitin 6 Sulfate antibody
Chondroitin-6 sulfate antibody was raised in mouse using chondroitinase ABC-digested adult human aggrecan as the immunogen.
Goat anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Purity:Min. 95%DUSP3 antibody
The DUSP3 antibody is a highly effective monoclonal antibody that acts as an inhibitor for the mineralocorticoid receptor. It has the ability to interfere with the activity of interferons and growth factors, making it a valuable tool in various research applications. This antibody specifically targets nuclear receptors and has been extensively tested for its efficacy and specificity. In addition, it can be used in combination with other biomolecules such as polyclonal antibodies, ornithine, transferrin, and haloperidol to form protein complexes that have a wide range of applications. The DUSP3 antibody has also shown promising results in inhibiting interleukin-6 activity, making it an important tool for studying immune responses and inflammation.
PGAM1 antibody
The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.
FOXG1A antibody
FOXG1A antibody was raised using the N terminal of FOXG1A corresponding to a region with amino acids GAPEGQRQLAQGDRRGRGICPVGPDEKEKARAGGEEKKGAGEGGKDGEGG
Goat anti Human IgG (FITC)
Goat anti-human IgG (FITC) was raised in goat using human IgG gamma chain as the immunogen.
Purity:Min. 95%Pneumocystis carinii antibody
Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.
HSV1 + HSV2 antibody (biotin)
HSV1/HSV2 antibody (biotin) was raised in rabbit using Strain F as the immunogen.RASGRP4 antibody
The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.
Hexokinase Type 1 antibody
Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.
DECR1 antibody
The DECR1 antibody is a highly specialized peptide agent used in Life Sciences research. It is designed to target and neutralize antiphospholipid antibodies, which are reactive molecules found in human serum. This antibody exhibits catalase activity, making it an effective tool for studying the function of catalase enzymes. Additionally, the DECR1 antibody has been shown to bind to basic proteins and globulins, further expanding its potential applications in various research fields. As a glycoprotein with anticoagulant properties, this antibody can be used to investigate the role of autoantibodies in coagulation disorders. Researchers rely on the specificity and reliability of the DECR1 antibody to advance their understanding of complex biological processes.
PIGR antibody
The PIGR antibody is a highly specialized monoclonal antibody that targets the polymeric immunoglobulin receptor (PIGR). This receptor plays a crucial role in the transportation of antibodies across mucosal surfaces, such as those found in the respiratory and gastrointestinal tracts. The PIGR antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.
p63 antibody
The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.
Anti-HIV P24 monoclonal antibody
Please enquire for more information about Anti-HIV P24 monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
KCTD11 antibody
KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL
STAT5A antibody
The STAT5A antibody is a highly effective medicament that targets the STAT5A protein, a key player in various cellular processes. This antibody specifically binds to STAT5A and inhibits its activity, leading to a decrease in TGF-beta signaling and reduced microvessel density. The use of this antibody has shown promising results in blocking IL-17A-induced inflammation and has been used as a research tool to study the role of STAT5A in oncogenic kinase signaling pathways. Additionally, this antibody can be used for immunohistochemistry and Western blotting to detect and quantify STAT5A protein levels in cells and tissues. With its high specificity and sensitivity, this monoclonal antibody is an indispensable tool for researchers studying growth factors, messenger RNA regulation, and protein inhibitors.
VSV-G antibody
VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.
Purity:Min. 95%B7H4 antibody
The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.
EGF antibody
The EGF antibody is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for its ability to inhibit the binding of EGF to its receptor, preventing downstream signaling pathways that promote cell proliferation and survival. The EGF antibody can be immobilized on streptavidin-coated surfaces or used in solution-based assays. It has been shown to be cytotoxic towards cells that rely heavily on EGF signaling for their growth and survival. Additionally, this antibody has been used in studies to investigate the role of EGF in various biological processes, such as wound healing and cancer progression. With its high specificity and affinity for EGF, the EGF antibody is an invaluable tool for researchers studying the effects of this growth factor and developing potential therapeutic inhibitors.
BAG2 antibody
BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK
RORA antibody
RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.
Purity:Min. 95%PLD3 antibody
PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Purity:Min. 95%RNF212 antibody
RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS
Rabbit anti Rat IgG (H + L) (HRP)
Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.
Purity:Min. 95%p63 antibody
The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.
MYLIP antibody
MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
PARP2 antibody
The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.
PSAP antibody
The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%ZNF319 antibody
ZNF319 antibody was raised in rabbit using the N terminal of ZNF319 as the immunogenPurity:Min. 95%Cdk3 antibody
The Cdk3 antibody is a monoclonal antibody that specifically targets and binds to sclerostin, a protein involved in the regulation of bone metabolism. This antibody has been extensively validated in various assays, including colloidal gold immunolabeling and nuclear staining. It has been widely used in research studies within the Life Sciences field to investigate the role of sclerostin in bone development and diseases such as osteoporosis.
TP53 antibody
TP53 antibody is an inhibitory factor that targets the TP53 gene, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody specifically binds to the TP53 protein, blocking its activity and inhibiting hepatocyte growth. It can be used in various research applications in Life Sciences, such as Western blotting, immunohistochemistry, and immunofluorescence. The TP53 antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options based on their specific needs. It has been validated for use in multiple species and has been shown to have high specificity and sensitivity. Additionally, streptavidin conjugates are available for enhanced detection when using biotinylated secondary antibodies. The TP53 antibody is supplied in a convenient format with appropriate storage conditions and contains no unnecessary excipients that could interfere with experimental results. Whether studying the role of TP53 in cancer biology or investigating its interaction with other proteins like c-myc
Chicken anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
ZNF420 antibody
ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
COL1A1 antibody
The COL1A1 antibody is a polyclonal antibody that specifically targets collagen type I alpha 1 chain. It can be used in various research applications, including immunohistochemistry and western blotting. This antibody plays a crucial role in the study of lipoprotein lipase and its interaction with collagen. Additionally, it has been shown to have potential therapeutic applications in diseases such as trastuzumab-resistant breast cancer.
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
MTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
KLK6 antibody
KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
RDX antibody
RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT
IL3 antibody
The IL3 antibody is a monoclonal antibody that has cytotoxic properties and is used in the field of Life Sciences. It specifically targets the chemokine angptl3 and acts as a neutralizing agent. This monoclonal antibody inhibits the growth factor activity of angptl3, which is a glycoprotein involved in adipose tissue regulation. By blocking the function of angptl3, this antibody can potentially be used as a therapeutic tool for various conditions related to adipose tissue dysfunction. The IL3 antibody is widely recognized in the scientific community for its high specificity and potency, making it an essential tool for researchers studying the role of angptl3 in different physiological processes. In addition to its use in research, this antibody also has potential applications in clinical settings for targeted therapy against diseases associated with dysregulated adipose tissue.
WWOX antibody
The WWOX antibody is a synthetic antibody that has been developed as an inhibitor for certain autoimmune disorders. It specifically targets autoantibodies that are responsible for causing endotoxemia, a condition characterized by the presence of harmful toxins in the bloodstream. The WWOX antibody works by binding to these autoantibodies and neutralizing their cytotoxic effects on the body's cells.
FLT1 antibody
The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.
RGS2 antibody
The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.
Donkey anti Rat IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Purity:Min. 95%Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
