Primary Antibodies

human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized

CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.

ACSL1 antibody was raised in Rabbit using Human ACSL1 as the immunogen

MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

Affinity purified Rabbit polyclonal Importin 7 antibody

The FADD antibody is a monoclonal antibody that targets α-syn, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to neutralize the harmful effects of α-syn and reduce its accumulation in the brain. This antibody also inhibits endothelial growth factor and promotes the growth of mesenchymal stem cells, which are involved in tissue repair and regeneration. Additionally, the FADD antibody has been used to measure microvessel density in blood plasma samples using particle chemiluminescence emission. It is a valuable tool for researchers in the field of life sciences studying neurodegenerative diseases and angiogenesis.

Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. Extensive research has shown its high activity on human erythrocytes using the patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Affinity purified Rabbit polyclonal UGT1A9 antibody

NEFL antibody was raised in Rabbit using Human NEFL as the immunogen

ANAPC4 antibody was raised in Rabbit using Human ANAPC4 as the immunogen

Affinity purified Rabbit polyclonal PRNP antibody

The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.

TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen

Recombinant human IL-6

ABCA2 antibody was raised in Rabbit using Human ABCA2 as the immunogen

PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.

HIST1H1C antibody was raised in Rabbit using Human HIST1H1C as the immunogen

CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.

Rabbit polyclonal Collagen I alpha 2 antibody

Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.

Rabbit polyclonal SLC6A13 antibody

FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen

Affinity purified Rabbit polyclonal alpha 2 Antiplasmin antibody

Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.

The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.

Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.

The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.

Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.

Rat monoclonal Integrin beta 7 antibody (FITC)

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

Affinity purified Rabbit polyclonal BUB3 antibody

LEO1 antibody was raised in Rabbit using Human LEO1 as the immunogen

The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.

Rat monoclonal BP1 antibody (PE)

PLP1 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It specifically targets and binds to PLP1, a protein expressed in cardiomyocytes. This antibody has been shown to modulate mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in cell growth and differentiation. Additionally, PLP1 antibody can be used in Life Sciences research as a tool for studying the functions of PLP1 and its implications in various physiological processes. This monoclonal antibody is highly specific and exhibits high affinity for PLP1, making it an ideal choice for experiments requiring precise targeting of this protein. Furthermore, PLP1 antibody has been validated for use in human serum samples and has shown activation of protein kinase pathways.

Rel antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody is produced using state-of-the-art technology and contains high-quality excipients to ensure stability and efficacy. Rel antibody has been extensively tested and validated for use in various applications, including ELISA assays, Western blotting, immunohistochemistry, and more. It is highly specific and exhibits strong binding affinity towards EGF, making it a valuable tool for studying EGF-related signaling pathways. Whether you're investigating the role of EGF in cancer development or exploring its effects on insulin signaling, Rel antibody is an essential component of your research toolkit. Trust in its reliability and accuracy to enhance your scientific discoveries.

The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.

WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT

B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

FKBP7 antibody was raised in Rabbit using Human FKBP7 as the immunogen

Affinity purified Rabbit polyclonal PSMC6 antibody

Strongzyme Goat anti Rabbit IgG (H + L) secondary antibody (HRP)

The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.

PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

Rabbit polyclonal GRIN1 antibody (Splice Variant C2)

Affinity purified Rabbit polyclonal ILBP antibody

PDE1B antibody was raised in rabbit using the middle region of PDE1B as the immunogen

Rabbit polyclonal CSTF1 antibody

BRUNOL6 antibody was raised in Rabbit using Human BRUNOL6 as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.