Primary Antibodies

Rat monoclonal CD25 antibody (biotin)

Mouse monoclonal ARHGAP25 antibody

Rabbit polyclonal SNAPIN antibody

ZNF44 antibody was raised in mouse using recombinant Human Zinc Finger Protein 44 (Znf44)

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.

Rabbit polyclonal OR10J6 antibody

Mouse monoclonal EPSP synthase antibody

Rabbit polyclonal CD19 antibody (Tyr531)

Rabbit polyclonal WBP11 antibody

MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

The CD105 antibody is a monoclonal antibody that is used in various applications related to angiogenesis and antiangiogenic therapy. It specifically targets CD105, also known as endoglin, which is a marker for microvessel density. The CD105 antibody works by binding to the antigen and forming an antigen-antibody complex, which can be detected using different techniques such as fluorescence immunochromatography or polymerase chain reaction (PCR). This specific antibody has been shown to be effective in detecting angiogenic factors and autoantibodies in human serum samples. Its high specificity and sensitivity make it a valuable tool for research and clinical diagnostics.

The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.

The JNK antibody is a highly specialized monoclonal antibody that targets the protein kinase known as JNK (c-Jun N-terminal kinase). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It has been found to inhibit the activation of JNK, which plays a crucial role in cellular processes such as apoptosis, inflammation, and glucose metabolism. Additionally, this antibody has shown potential in targeting other proteins like prorenin and sclerostin. With its high specificity and efficacy, the JNK antibody is a valuable tool for researchers in their quest to understand and manipulate cellular signaling pathways.

Benzoylecgonine antibody was raised in mouse using benzoylecgonine-KLH Conjugate as the immunogen.

Rabbit polyclonal TADA3L antibody

LILRA4 antibody was raised in Rabbit using Human LILRA4 as the immunogen

Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.

Rabbit polyclonal ABL1 antibody (Tyr412)

Rabbit polyclonal WRKY27.1 antibody

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

LNPEP antibody was raised in Rabbit using Human LNPEP as the immunogen

The L1CAM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets L1CAM, a glycoprotein involved in cell adhesion and migration. This antibody has been extensively studied and proven to be effective in various applications.

The Human Nuclei antibody is a monoclonal antibody that specifically targets the nuclei of human cells. It recognizes sugar moieties on nuclear proteins and can be used for various applications in life sciences research. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection of human nuclei in tissue samples.

BIRC8 antibody was raised in Rabbit using Human BIRC8 as the immunogen

The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.

Rabbit polyclonal CCR5 antibody (Ser336)

The STX1A antibody is a versatile diagnostic reagent and medicament that belongs to the group of antibodies. It specifically targets β-catenin, a growth factor involved in various cellular processes. The STX1A antibody can be used in research and clinical settings for the detection and quantification of β-catenin levels. It has been shown to exhibit high specificity and sensitivity in antigen-antibody reactions, making it a reliable tool in the field of Life Sciences. The STX1A antibody is available as a monoclonal antibody conjugated with magnetic particles or microparticles, enabling easy separation and purification of target proteins. With its exceptional binding affinity and selectivity, the STX1A antibody is an indispensable tool for studying granulosa cell function and other biological processes.

Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.

EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

C1orf50 antibody was raised in Rabbit using Human C1orf50 as the immunogen

CAPRIN2 antibody was raised in Rabbit using Human CAPRIN2 as the immunogen

The Progesterone receptor antibody is a highly specific monoclonal antibody that targets the progesterone receptor. It is designed to bind to the receptor and inhibit its activity, making it an essential tool for studying the role of progesterone in various biological processes.

Complement C3b beta antibody was raised in mouse using human complement component C3 as the immunogen.

The NGAL antibody is a monoclonal antibody that specifically targets and binds to neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important protein involved in various biological processes, including inflammation, cell growth, and iron metabolism. This antibody can be used in research and diagnostic applications to detect NGAL levels in human serum or tissue samples. It is commonly used in life sciences and clinical laboratories for studying the role of NGAL in different diseases and conditions. The NGAL antibody can also be conjugated with streptavidin or other molecules for specific applications such as immunohistochemistry or ELISA. With its high specificity and sensitivity, this antibody is a valuable tool for researchers and healthcare professionals working in the field of molecular biology and diagnostics.

LAP3 antibody was raised in Rabbit using Human LAP3 as the immunogen

GPR18 antibody was raised in rabbit using the middle region of GPR18 as the immunogen

FAM185A antibody was raised in Rabbit using Human FAM185A as the immunogen

Peripherin antibody is a polyclonal antibody that specifically targets and neutralizes interleukin, a key player in various immune responses. This antibody is highly effective in blocking the activity of interleukin and can be used in research and diagnostic applications. The colloidal nature of this antibody allows for easy and efficient binding to target molecules, ensuring accurate and reliable results. In addition to its neutralizing properties, peripherin antibody has been shown to inhibit the signaling pathway involving β-catenin, a protein involved in cell adhesion and growth regulation. This makes it a valuable tool for studying the role of β-catenin in various biological processes. Furthermore, this antibody has been successfully used in studies involving helicobacter growth factor and epidermal growth factor, further highlighting its versatility in different research areas. With its high specificity and affinity, peripherin antibody is an essential component for any life sciences laboratory or research facility.

FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

The SUV39H1 antibody is a high-quality polyclonal antibody that specifically targets the SUV39H1 protein. This protein is a histone methyltransferase that plays a crucial role in gene regulation and chromatin organization. The SUV39H1 antibody is designed to detect and bind to the activated form of SUV39H1, making it an essential tool for researchers studying epigenetics and gene expression.

Rabbit polyclonal NUP54 antibody

The L Selectin antibody is a powerful tool for researchers studying actin filaments and protein kinases. This antibody specifically targets L Selectin, a cell surface glycoprotein involved in leukocyte adhesion and migration. By binding to L Selectin, this antibody can inhibit its function and block the interactions between leukocytes and endothelial cells.

Rabbit polyclonal CPXM2 antibody

Affinity purified Rabbit polyclonal ATP2A2 antibody

Mouse monoclonal TCR antibody (allophycocyanin)

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.