Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Caspase 7 antibody
The Caspase 7 antibody is a highly specialized nuclear receptor that plays a crucial role in apoptosis, the process of programmed cell death. This antibody specifically targets and binds to the HER2 protein, making it an effective anti-HER2 antibody. It belongs to the group of polyclonal antibodies, which are derived from multiple B-cell clones and can recognize different epitopes on the target protein.
C-myc antibody
The C-myc antibody is a monoclonal antibody that specifically targets the C-myc protein, a transcription factor involved in cell growth and proliferation. This antibody is widely used in life sciences research to study the expression and function of C-myc in various biological processes.
CD82 antibody
The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.
CXCL12 antibody
CXCL12 antibody was raised in rabbit using the middle region of CXCL12 as the immunogen
DKFZP761C169 antibody
DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
DNASE1L3 antibody
DNASE1L3 antibody was raised in rabbit using the C terminal of DNASE1L3 as the immunogen
GNAI1 antibody
GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Factor VIII antibody
Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.
FZD6 antibody
The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.
Crystallin Mu antibody
Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA
HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in goat using purified native p24 from strain IIIB as the immunogen.Hemocyanin antibody
The Hemocyanin antibody is a valuable product in the field of Life Sciences. This antibody specifically targets fatty acids and is widely used in research involving Antibodies. It acts as a family kinase inhibitor, preventing the activation of kinases that play a crucial role in cell signaling pathways. Additionally, this antibody has been shown to interact with collagen, epidermal growth factor, and interleukin-6, making it an essential tool for studying the effects of these molecules on various biological processes.MFAP3L antibody
MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
AVEN antibody
The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.
TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
VEGFA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug offers a comprehensive approach to tackling Mycobacterium tuberculosis strains. Experience the exceptional potency of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis
TBRG4 antibody
The TBRG4 antibody is an antigen-specific antibody that is used in Life Sciences research. It is a polyclonal antibody that specifically targets TBRG4, a protein involved in various cellular processes. This antibody has been widely used in studies related to alpha-fetoprotein, natriuretic peptides, and albumin. It can be used in both monoclonal and polyclonal forms, depending on the specific research needs. The TBRG4 antibody has shown high specificity and sensitivity when used in assays such as ELISA and Western blotting. It has also been used to detect TBRG4 expression in human serum samples and to study its role in interferon signaling and growth factor regulation.
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
