Primary Antibodies

CENPO antibody was raised in Rabbit using Human CENPO as the immunogen

Affinity purified Rabbit polyclonal ALASE antibody

GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

The p70 antibody is a highly specialized product in the field of Life Sciences. It is commonly used in chromatographic techniques to detect and analyze the presence of activated proteins, such as β-catenin and cox-2 inhibitor. This antibody is also widely used in bioassays and immunoassays to study the expression and localization of specific proteins, including collagen and ginsenoside.

Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.

The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.

Rabbit polyclonal GABRB3 antibody (Ser408/409)

PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.

ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogen

ERBB2 antibody was raised in Rabbit using Human ERBB2 as the immunogen

The NFIB antibody is a polyclonal antibody that is used in various immunoassays and life sciences research. It specifically targets the nuclear factor I/B (NFIB) protein, which plays a crucial role in regulating gene expression and cellular processes. This antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

The CD18 antibody is an essential tool in the field of Life Sciences. It belongs to the category of antibodies and is widely used for research purposes. This antibody specifically targets CD18, a protein that plays a crucial role in cell adhesion and immune response.

The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.

PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Purified Rabbit polyclonal MYB53 antibody

Affinity purified Rabbit polyclonal Vanin 1 antibody

USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The CDK5 antibody is a highly effective neutralizing agent that specifically targets the cyclin-dependent kinase 5 (CDK5). This monoclonal antibody has been extensively studied and has shown remarkable results in inhibiting the activity of CDK5. By binding to CDK5, this antibody prevents its interaction with other proteins and disrupts the signaling pathways involved in cell proliferation and differentiation.

The MEF2C antibody is a highly specific monoclonal antibody that targets the MEF2C protein. This protein plays a crucial role in various biological processes, including cholinergic signaling, adeno-associated virus formation inhibition, and growth factor regulation. By binding to MEF2C, this antibody can modulate its activity and potentially impact the function of downstream pathways.

Affinity purified Rabbit polyclonal SLC6A4 antibody

This product is a protein A purified mouse monoclonal antibody with clones of the immunoglobulin subclasses: IgG1 and IgG2a available. These clones recognise human D-Dimer and high molecular weight fibrin degradation products and no cross-reactions is observed with fibrinogen and D-monomer. A potential application of this product is for coating to latex particles for latex enhanced immunoturbidimetric applications. It can further be used in ELISA and immunofluorescent assays.
Human D-dimer, a soluble fibrin degradation product recognised by this antibody product, can be used as a marker for clinical conditions where the process of coagulation and fibrinolysis have been activated. For example it can be used in the diagnosis of venous thromboembolism and intravascular coagulation. The formation of human D-dimer occurs when fibrinogen is converted to fibrin monomers when the enzyme thrombin cleaves fibrinopeptides at the N-terminal domain of fibrinogen. These monomers aggregate when interacting with another enzyme: activated factor XIII (factor XIIIa) forming a cross-linked fibrin polymer, also known as a fibrin clot. A final enzyme, plasmin, degrades this fibrin clot, resulting in D-dimer. It is important to note that when applying this product clinically, levels of D-dimer can be influenced by human factors such as age, pregnancy and cancer.

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.

Affinity purified Rabbit polyclonal GRAP2 antibody

CD81 antibody was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen

Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.

The ITGA3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing proteins. It is a polyclonal antibody that can be used in various life science applications. The ITGA3 antibody has been shown to have an inhibitory effect on colony-stimulating factors and fibrinogen, which are important for cell growth and survival. This antibody can also activate phosphatase and 3-kinase pathways, which play a role in cellular signaling. Additionally, the ITGA3 antibody has been used as a monoclonal antibody to target TNF-related apoptosis-inducing molecules and inhibit their activity. Studies have also shown that this antibody can reduce microvessel density, suggesting its potential as an anti-angiogenic agent.

Affinity purified Rabbit polyclonal ZNF313 antibody

BCL10 antibody was raised in Rabbit using Human BCL10 as the immunogen

Affinity purified Goat polyclonal Eotaxin 3 antibody

Purified Polyclonal GNG8 antibody

Sheep polyclonal Tacrolimus 22 antibody

FBXO7 antibody was raised in Rabbit using Human FBXO7 as the immunogen

FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES

Purified Polyclonal ADRB2 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.