Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Goat anti Human IgG (rhodamine)
Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.
Purity:Min. 95%IGJ antibody
The IGJ antibody is a monoclonal antibody that specifically targets insulins. It is cytotoxic and works by binding to insulin molecules, rendering them inactive. This colloidal antibody has neutralizing properties, meaning it can effectively counteract the effects of autoantibodies that may be present in the body. The IGJ antibody is designed to target specific amino acid residues on insulin, ensuring precise and effective binding. It has been extensively tested in Life Sciences research and has shown high affinity for insulin in human serum samples. With its histidine-rich structure, this monoclonal antibody offers a reliable tool for studying insulin-related processes and mechanisms.
TRIM32 antibody
The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.
CIITA antibody
The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.
TBC1D16 antibody
TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF
GPX7 antibody
The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.
CD4 antibody (allophycocyanin)
Mouse monoclonal CD4 antibody (allophycocyanin); human target; IgG1 kappa; clone RPA-T4
CD81 antibody (biotin)
CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.
Purity:Min. 95%SHARPIN antibody
SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen
Purity:Min. 95%MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
CDC42 antibody
The CDC42 antibody is a highly specific and potent polyclonal antibody that targets the protein CDC42. It can also be used as a monoclonal antibody. CDC42 is a small GTPase protein that plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. This antibody has been extensively tested and validated for its ability to neutralize the activity of CDC42, making it an invaluable tool for researchers in the field of life sciences.
TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
MARVELD2 antibody
MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Purity:Min. 95%Tenascin antibody
The Tenascin antibody is a highly specialized recombinant protein that belongs to the class of chemokines. It is designed to target specific antigens and has been extensively studied in the field of Life Sciences. This antibody exhibits strong binding affinity towards glycoproteins, making it an ideal tool for research purposes. It has also been used in studies related to hyperammonemia and shows promising results in inhibiting the growth of cancer cells, such as MCF-7. The Tenascin antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. With its ability to effectively neutralize target proteins, this antibody holds great potential for therapeutic applications, including the development of antibody-drug conjugates. Whether you're conducting cutting-edge research or exploring new avenues in drug discovery, the Tenascin antibody is a valuable tool that can significantly contribute to your scientific endeavors.
Anti-PGII antibody
The Anti-PGII antibody is a highly specialized drug antibody that is used in immunoassays within the field of Life Sciences. This antibody specifically targets and neutralizes the effects of PGII, a fatty acid known for its role in adipose tissue. By neutralizing PGII, this antibody helps to regulate viscosity levels and maintain proper adipose function. Additionally, it has been found to have antiestrogen properties and can inhibit the activity of cdk4/6, enzymes involved in cell division. The Anti-PGII antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and offers high specificity and potency in its action. With its ability to target and modulate various biological processes, this antibody holds great promise for research and therapeutic applications within the field of Life Sciences.Purity:≥90% By Sds-PageRabbit anti Human IgG (Texas Red)
Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%SLC12A5 antibody
The SLC12A5 antibody is a monoclonal antibody that targets the growth factor receptor HER2. It specifically binds to the carbonyl group on HER2, inhibiting its signaling pathway and preventing cell proliferation. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the growth of cancer cells that overexpress HER2. Additionally, the SLC12A5 antibody can be used for immobilization on electrodes to study protein-protein interactions or actin filament dynamics. Its high specificity and affinity make it a valuable tool for researchers studying various biological processes. Furthermore, this antibody has cytotoxic activity against cells expressing the antigen CD33, making it a potential therapeutic option for certain types of cancer.
CD44 antibody
The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.
GSTP1 antibody
GSTP1 antibody was raised in Mouse using a purified recombinant fragment of human GSTP1 expressed in E. coli as the immunogen.Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
