Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MAD2 antibody
The MAD2 antibody is a highly effective active agent that plays a crucial role in regulating cell division. It specifically targets messenger RNA (mRNA) and cell antigens, making it an essential tool in the field of Life Sciences. The MAD2 antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments.
Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
SIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.GPR132 antibody
The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.
COL1A1 antibody
COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.
Transglutaminase 2 antibody
Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.
Collagen I antibody
The Collagen I antibody is a highly specialized antibody that targets the amino-terminal region of collagen, a crucial protein in the extracellular matrix. This antibody has been extensively studied and proven to be effective in various research applications in Life Sciences.
PNPase antibody
The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.
RGS3 antibody
RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
Clostridium difficile toxin A antibody
Clostridium difficile toxin A antibody is a highly specialized antibody that specifically targets the cytotoxic molecule produced by Clostridium difficile bacteria. This antibody, available in both polyclonal and monoclonal forms, is used to neutralize the toxin and prevent its harmful effects on cells. By binding to the toxin, the antibody inhibits its ability to cause cell cytotoxicity.
PSAT1 antibody
The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).
Denosumab
CAS:Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Purity:(Sec-Hplc) Min. 95 Area-%Color and Shape:Clear LiquidRef: 3D-BD165585
Discontinued productHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
